KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111780954Help
Entry
111780954         CDS       T05351                                 

Definition
(RefSeq) protein S-acyltransferase 10-like
  KO
K18932  palmitoyltransferase [EC:2.3.1.225]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    111780954
Enzymes [BR:cpep01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     111780954
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 111780954
NCBI-ProteinID: XP_023517090
Position
LG19
AA seq 340 aa AA seqDB search
MIMDVCRPRDFLDRTMDRYVRLFPCLSDPARRSSSGLKVALVMLHLVYVGLLFAFDRHLI
EEAETRPWYTASYLLLVVATLIQYFLTSCSSPGYVLDAMRASNEKDIAFRKASKQPASSK
NVDVVVTIDRNQVGKNVQGDLTSWTKIVIAVFSLFCRNFTCSYCHVEQPPRTKHCHDCDR
CVLQFDHHCVWLGTCIGQGNHCRFWWYIFEETTLCLWTGILFISYLKADIVRAWWNAAIV
IMLLITLSIALIFLLLLLLFHSYLVLTNQTTYELVRRRRIFYLRGIPERVFPFSKGVCHN
LYDFCCHRSVYQLEPLPSVQALEERSRPYTCSDLLRCRCC
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgataatggatgtttgccgccctcgcgacttcttggatcgaacaatggaccgatacgtt
cgccttttcccctgcctctccgatcctgctcggagatcttcatcgggtttaaaagtagca
ttggtgatgctgcacctggtttatgttggacttctctttgcattcgaccggcatttgatt
gaagaagccgaaactagaccgtggtacacagcttcatatttgttgcttgttgtcgctacc
ctcattcaatactttttaacatcatgttcatctcctggctatgtacttgatgcaatgagg
gcttctaatgagaaagatattgcttttcgaaaggcatcaaaacaacctgcttcaagcaaa
aatgtagatgtggttgttactatagaccggaaccaggttggaaaaaatgttcagggagat
ttaacatcgtggacgaaaattgtaattgctgttttttctttgttttgcagaaattttact
tgctcctattgtcatgttgagcagcctccgcgaacaaagcattgccatgattgtgatcga
tgtgtacttcagtttgatcatcactgtgtttggcttgggacatgtattggccagggcaat
cattgtcgattctggtggtacatttttgaggagacaactttatgcttgtggactggaatc
ttgttcatttcatacctcaaggctgatatagtgcgggcatggtggaatgctgccattgtc
attatgctgctgattactttgtcgattgccttgatctttctactactcttgcttctattt
catagctatcttgttcttacaaatcagactacgtacgaactcgtgagacgtaggcgaatc
ttttacttaaggggcattcctgaaagagtttttcccttcagcaaaggagtttgccataat
ttgtatgatttctgctgtcatagaagcgtctatcaattggagcccctaccgtcggttcaa
gcattggaagagagatcgaggccgtacacatgttcggatctcttgcgatgtagatgctgc
tga

DBGET integrated database retrieval system