KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111781253Help
Entry
111781253         CDS       T05351                                 

Definition
(RefSeq) tRNA wybutosine-synthesizing protein 2/3/4
  KO
K15450  tRNA wybutosine-synthesizing protein 3 [EC:2.1.1.282]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cpep03016]
    111781253
Enzymes [BR:cpep01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.282  tRNAPhe 7-[(3-amino-3-carboxypropyl)-4-demethylwyosine37-N4]-methyltransferase
     111781253
Transfer RNA biogenesis [BR:cpep03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    111781253
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TYW3 Met_10 Kelch_6 Kelch_4 Kelch_1 Kelch_5 Kelch_3 Kelch_2 MTS DNA_methylase Cons_hypoth95
Motif
Other DBs
NCBI-GeneID: 111781253
NCBI-ProteinID: XP_023517513
Position
LG19
AA seq 1051 aa AA seqDB search
MEFEKRKAAAMASLGSTETDKSPKGSLDTPIIPLINTLNNHPSYFTTSSCSGRISILSQP
VCSTSAAAPKPRKKALGGSWLFVSHEFADPNSVIDLLFRSPSTNGELSELVFRFEPLIIA
IECKDLGSAQDLVSTAISSGFRESGITSASKRVIIAIRCSIRMEVPLGTTEKIMVSPEYV
RYLVDVANEKMVANKKRTDGFLKALQSRVAAVTNVSQTCQGISLREAMEEANDLLDSKEH
SCADEEDCGALEGGNRNANSGSSEACNYSLSVEQMGISGEPMAKLFIWGHSATTVHNKVI
AFGGFGGMGRHARRNDLLQLDMLSCTLQTINVEDSPSPRLGHTSSLVGDCLYVIGGRTDP
TYILNDVWVFDITQEKWTLLKCTGSSFSPRHRHAAAAVGSKIYVFGGLENDRISSSLIVL
NTDTHQWKEIQAGGDQPCGRHSHSMVSYGSHLYMFGGYDGEKAFGDLYSFNTENCFWKKE
NIAGRTPNARFSHAMFVYENYIGIIGGCPVSQSYQEFALLDLQHRFWRHVSLNCTGKELF
VRCTANVVGDDLVLVGGGASCYAFGTNFSEPAKIRLRPLISSEVILGHPRNTENLVTHPI
EELEKESRDPECLLNGNAQTFNEASGFNIDSEKSNSHEKEGALYWVLKIERNYAKLGKDI
LKRFGWLDLARKVSSRGSGTHIFFPVNGKFCDMFDEKKSWWGDQLEPENDFHISELESWE
GGLTNKCSYLKALNILRKCSATKLVDEVVDIKTAAKSPYKKMSEAVSSLLKHNGSSEGLL
EELPTRWERLGDIVVLPVTSFKDPTWDTIGEELWPLVAKSLGTCRLARQGRVASTGTRDS
NLEILVGDNGWVDHRENGITYSFDATKCMFSWGNLSEKLRMAHLDCKDETVVDLFAGIGY
FVLPFLVGAKAKLVYACEWNPHAIEALKRNLQANCVSNRCIVLEGDNRETAPKGVADRVC
LGLLPTSEGSWVTAVRALRIEGGTLHVHGNVKDSEEELWTQHLRHSITEIAKSEGHCWDV
SVEHIERVKWYAPHIRHLVVDVRCKRIQQNS
NT seq 3156 nt NT seq  +upstreamnt  +downstreamnt
atggaatttgagaagaggaaagctgcggccatggcgtcactgggctcaactgagaccgac
aaatcacctaagggaagcttggataccccaattatacctcttatcaacactctcaacaac
catccatcttacttcaccacaagttcctgctctggtcgtatttcaattctctctcaacca
gtctgtagcacctctgccgccgccccgaagccgaggaagaaagctctaggtggttcttgg
ctgtttgttagtcacgagtttgccgatcccaactcagtaatcgacctcctcttccgttct
ccatcaactaatggggagttatctgagctcgtgttcaggttcgaacctctcatcatagca
attgaatgcaaggaccttggatcggctcaggatttggtttccactgctatatctagtggg
ttcagagaatcaggcattaccagtgctagcaagcgtgtgataattgcaattcgctgttca
attcgaatggaggtgcctttgggaactaccgaaaagattatggtctcacccgagtacgtc
cggtaccttgttgatgtagcaaatgagaagatggtggccaataagaagagaactgatggg
tttctgaaggcattgcaaagtcgtgttgctgcggttactaatgtttcgcagacgtgtcaa
ggaatatcattgagggaggcaatggaggaggcaaatgatttgctcgatagcaaggaacat
agttgtgctgatgaggaagattgtggagctttagaaggcgggaataggaatgccaattct
ggatcatcagaagcatgcaattatagtttatctgttgaacagatgggcatttcaggagaa
cctatggcaaagctttttatttgggggcactcagccactactgttcacaataaagttatt
gcatttggtggatttggaggcatgggcagacatgcaagaagaaatgatttgttacaactt
gatatgttgtcatgcacattgcagacgatcaatgtagaggatagtccatctcctcgtttg
ggtcacacatcatctttggttggagattgcctttatgtcattggtggcaggacagatcct
acgtacattctgaatgatgtatgggtctttgatatcactcaggaaaaatggacgttatta
aaatgcactggtagctctttctctcctaggcaccgtcatgctgcagcagcagtaggctca
aagatttatgtatttggtggacttgagaatgacagaatctcatcttccttgattgtcctc
aacacagatactcatcagtggaaagaaattcaggctggtggtgatcagccatgtggtcgt
cattcacactcaatggtttcttatgggtcgcatttatatatgtttggggggtatgatggg
gagaaagcttttggagacttatattcttttaatacagaaaattgtttttggaagaaagaa
aatatagcggggagaactccaaatgcaaggttttcccatgcgatgtttgtgtatgaaaat
tatattggaattattggaggttgccctgtgagccaaagctatcaagagtttgcattactt
gatttgcagcatcgtttctggagacacgtgtccctaaattgtactggcaaggaattattt
gtacgttgcacagccaatgtggttggtgatgatcttgtcctagttggtggtggagcatcc
tgttacgcatttgggacgaactttagtgagccagcgaaaattaggttgcgtccattgata
tcctcagaggttattttagggcatcctcgaaacacagaaaaccttgtgactcatcccatt
gaagagttggagaaggagagcagagatcctgaatgtctgctcaatggcaatgctcaaact
ttcaatgaagcgtctggttttaatattgatagtgaaaaatccaattcccatgaaaaagaa
ggtgctttgtattgggttttaaaaattgaaagaaattatgcaaaactagggaaagacatt
ttaaagaggtttgggtggctggatctggctagaaaggtttcttcacgtggtagtggaaca
catattttctttccagtgaatggaaaattttgtgatatgtttgatgaaaagaagtcctgg
tggggagatcaacttgaaccggaaaatgactttcatatctctgaacttgaaagttgggaa
ggaggcctgacaaataaatgctcttatctaaaagctttgaatattttaaggaaatgtagt
gcaactaaactggtggatgaagttgttgatataaaaactgcagccaaatctccatataaa
aagatgagcgaagcagtatcctctttgctaaagcataatggctcatctgaaggactcttg
gaggagctgccaacaaggtgggagcgacttggggatattgtggttcttccagtcacatct
tttaaggatcctacatgggacactattggggaggagctgtggcctttggttgccaaatca
cttggtacttgtcgtcttgctcgccaaggaagagttgcttcgactggtacaagggatagt
aacttagagattctagtgggagataatggttgggttgaccatcgagaaaatggaataact
tattctttcgatgccactaagtgcatgttttcctggggaaatctttctgagaagctacgg
atggcccatctggactgtaaagatgagaccgttgtggatttatttgccggaattggatat
tttgtattgccatttcttgtcggggctaaagcaaagctggtctatgcttgtgagtggaat
cctcacgctattgaggcacttaaacgtaatttacaagctaattgcgtgagcaatcgttgt
attgttcttgaaggagataaccgggagacagcacccaagggagtagcggatcgggtttgt
cttggtctccttccaactagtgagggtagctgggtgacggctgtaagagcattgagaatt
gaaggcggcaccctacatgtgcatggtaatgtgaaggactcggaagaagaactgtggact
caacacctccggcactcaataactgaaattgctaaatctgaaggtcattgttgggatgtc
tcggtagaacacatcgaaagagtaaaatggtatgccccacacattcgccatcttgttgtg
gatgttcgatgcaaaaggattcaacagaacagctga

DBGET integrated database retrieval system