KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111782842Help
Entry
111782842         CDS       T05351                                 

Definition
(RefSeq) uncharacterized protein LOC111782842
  KO
K06195  ApaG protein
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    111782842
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF525 UVR DUF4354 CBM49
Motif
Other DBs
NCBI-GeneID: 111782842
NCBI-ProteinID: XP_023519429
Position
LG20
AA seq 291 aa AA seqDB search
MHSLSFKVLGDFNARSRMNLPGRGSFCVPEMEVGAMRCFGRHRAFGRTCRIVACASERNG
DGGGGKQSQSSSTSPSRSFLSRSETYALLKQQLEVAAKSEDYEEAARIRDSLKLFEEEEP
VLRLRRLMKEAISSERFEDAAKYRDELNEIAPHCLLKCASDATTLGIRVQVRSVYIEGRS
QPSKNHYFFAYRIRITNNSDRPIQLLRRHWIITDANGRTENVWGVGVIGEQPVILPRTGF
EYSSACPLSTANGRMEGDFEMKYIDRVGEQSFNVAIAPFSLSILGDSSDAF
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgcattcgttgagcttcaaggttttgggtgattttaatgcgagatcgaggatgaattta
ccgggacgaggaagcttttgtgttccggaaatggaggtcggggcaatgaggtgttttggg
cgccatcgagcatttggaagaacttgtaggattgtagcgtgcgcttcggagagaaatggt
gatggtggtggaggaaaacagagccagagctcgagtacgagtccgagtcgttcgtttctg
tcccgcagtgaaacttatgcactactgaaacagcaattggaggttgccgccaagtccgag
gattatgaagaagctgcaaggatacgcgactcgttaaaattatttgaagaggaagagcca
gttttgcgtcttcgaagattgatgaaggaggctatttctagtgagagatttgaggatgcc
gctaaatatcgtgatgagctgaatgaaattgcccctcactgtcttctgaaatgtgcaagt
gatgcaacaactttgggtatcagggtacaagttaggagcgtttacattgaagggcgaagc
caaccttcaaagaatcattacttttttgcatatcgaataaggataaccaataattcagac
cgtccaattcaacttctcagaagacattggattatcacggatgcaaatgggagaacagaa
aacgtctggggcgttggtgttattggtgaacaaccagtcatacttcctaggactggtttt
gaatattcatcagcatgcccattaagtactgctaacggcagaatggaaggtgactttgaa
atgaagtacattgatcgagtgggcgaacaatcatttaacgttgctattgctccattctct
ctctccatattaggagatagctcagatgctttctga

DBGET integrated database retrieval system