KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111783818Help
Entry
111783818         CDS       T05351                                 

Definition
(RefSeq) pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH10
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Pathway
cpep03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    111783818
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cpep03041]
    111783818
Enzymes [BR:cpep01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     111783818
Spliceosome [BR:cpep03041]
 Complex C
  Other components
   Step II factors
    111783818
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C DEAD AAA_22 AAA_30 T2SSE AAA_19 ABC_tran AAA_7 ATPase DUF2075 AAA_23
Motif
Other DBs
NCBI-GeneID: 111783818
NCBI-ProteinID: XP_023520426
Position
Unknown
AA seq 708 aa AA seqDB search
MERLGVNAKVSANDCRSENISRKRKIAEHRKSLPVASVEHLLIQEVHRNDTLVIVGETGS
GKTTQIPQFLFNAGFCRDGKAIGVTQPRRVAAVTVAKRVSEECGVEVGQKVGYSIRFEDV
TSSSTRIKYMTDGLLLREALLDPFLSRYSVIIVDEAHERTVNTDVLLGFLKKVQKTRSRS
LNDSLNAENMHANGLVVENGNNGKCASSLRQYRGRKLPPLKLIIMSASLDARLFSEYFGG
ARALRVQGRQHPVAIFYTRKHVSDYLEATLITIFQIHLEESPGDILAFLTGQEEIESIEN
LAKDKIQKLPESKQNIVVIPIYSALPSEQQLRVFAPTPPGVRKVILATNIAETSVTIPGI
KYVIDPGFVKARTYDPNKGMESLIVFPTSKAQALQRSGRAGREGPGKCFRQYPEDMFYKL
EDSTKPEIKRCNLSNVILQLKALGVDNIMEFDFLEEPPRQAIFKSLEQLILLGAVAHDGK
LSNPVGHLMARIPLDPIYSKALIVAGQFNCLEEMLITVSMLSVESIFYHPREKLEEARAK
MKCFSSLEGDHLTLINVYRSAEEFLNKKKLELSKEKVEKSLKKWCKENFINSRSLRHARD
VHSQIREHVEQMNLPLHSCGDDTIQFCRCLAASFFLNVATKQPDGTYRDCASGEVVQIHP
SSVLFRKKPDCVIFNEFVQTNHKYIRNITRIDRLWLSELAPHYYALQN
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atggaaagactgggagtcaatgccaaggtctcagctaatgattgcaggagcgaaaatatc
tccaggaagcgaaaaattgcagaacatagaaagtcactcccagtagcttcggttgaacat
ctgctcatacaagaggtgcatagaaatgatacattagtcatcgttggtgaaactgggagt
ggaaaaacgacgcaaataccgcagttcctgtttaatgctggattttgtcgagatgggaaa
gctatcggggtgacccaacctcggcgtgttgctgcggtaactgttgctaaaagagtttct
gaggaatgtggtgttgaagttgggcaaaaggttgggtattccattagatttgaggatgta
acttctagttccacaagaatcaagtacatgactgatggtctactgctaagggaagcactg
ttggacccttttctctcaagatattcagttatcattgttgatgaagctcacgagagaaca
gttaatactgatgtattgctaggatttttgaaaaaagtgcagaaaacaagatctagatct
ttgaatgactctttgaatgctgagaacatgcatgctaatggcctagtggtagaaaatgga
aataatggtaaatgtgcaagttccctcaggcaatatcgtggaaggaaactacctccattg
aagttaattatcatgtctgccagcttagatgcacgccttttctctgagtactttggtggg
gcaagggctcttcgtgtccaggggcgtcaacatccagtggctatattttatactcgtaag
catgtatcagattatttggaggccactcttattactatatttcagattcatttggaggag
agtcccggtgatatacttgcatttttaactgggcaagaggagatagaatctattgaaaat
cttgccaaggacaagattcagaagttgcctgaaagcaaacagaacatagtagttattcct
atatattcagcccttccttcggagcaacaattgcgagtttttgccccaactccacctgga
gtccgtaaggtgatattggcaacaaacattgctgagacatccgtgacaatacctgggatc
aaatatgttattgatcctggatttgtaaaagcacgcacttatgatccaaacaaagggatg
gaatcattgattgtttttccaacctcaaaagcacaggcactacagaggagtgggcgtgct
ggccgtgaaggacctgggaaatgctttcgtcagtatcctgaggatatgttttataaactt
gaggattcaacaaagccagagataaagagatgcaacctttctaatgtcatcttacagttg
aaggctttaggcgttgataatatcatggaatttgatttcttggaagaaccaccaaggcaa
gctattttcaagtcgttggagcaattgattctgcttggggctgtagcacatgacggcaaa
ctatctaatccagtaggacatttgatggctcgtattccattagatccaatatactctaaa
gctttgattgttgccggtcagttcaactgtttggaagaaatgttgataactgtgtcaatg
ctctcagttgaatccattttttaccaccctcgtgagaagttagaagaggcaagagctaaa
atgaaatgtttttcaagtctggaaggtgatcatctcactctaatcaatgtgtatcgatct
gctgaggaatttttgaataagaaaaagttggaacttagcaaagaaaaagtggagaaaagc
ttgaaaaagtggtgcaaagaaaattttatcaatagcagatctttgagacacgcacgtgac
gttcacagtcaaattagggaacatgttgaacaaatgaatcttcctcttcactcttgtgga
gatgacacgattcagttttgtagatgcctagctgcttcctttttcctcaacgtagccaca
aagcagccagatggaacatacagggattgtgcaagtggtgaggtggtacagattcatccc
tcttctgtgctattccgcaaaaaaccagattgtgtaattttcaacgagttcgtgcaaact
aatcataagtacatccgcaatatcactagaattgatcgactttggctgtctgaactggct
ccgcattattatgcactgcaaaactaa

DBGET integrated database retrieval system