KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111788151Help
Entry
111788151         CDS       T05351                                 

Definition
(RefSeq) aspartate--tRNA ligase 2, cytoplasmic-like
  KO
K22503  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Pathway
cpep00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    111788151
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cpep01007]
    111788151
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cpep03016]
    111788151
Enzymes [BR:cpep01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     111788151
Amino acid related enzymes [BR:cpep01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   111788151
Transfer RNA biogenesis [BR:cpep03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    111788151
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon tRNA-synt_2d
Motif
Other DBs
NCBI-GeneID: 111788151
NCBI-ProteinID: XP_023524153
Position
LG02
AA seq 539 aa AA seqDB search
MSASSETPMDESLSAGVSKKAAKKEAAKQEKLRRRQEAAAEVAISSLDVEDDPLSANYGD
VPLSNLQSKEAKNIENWTQVGSLTGELKDKYVLLRGRVQTIRAVAKKMAFLVVREKGFTV
QCVVSEQPELVSRQMVKYVVGLSRESIVDVEGVVSVPNVAIKGATQQVEIQVRKVYCISK
AMPSLPINIEDAARSEAEIEKALQAGEQLVRVNQDTRLNYRVLDIRTPANQGIFRIQCQV
GAIFRQFLLSEGFVEIHTPKLIGGSSEGGASVFRLDYKGQPACLAQSPQLHKQMAICGDF
GRVFEIGPVFRAEDSYTHRHLCEFTGLDVEMEIKTHYSEVMNIVDRLFVKMFDSLNENCM
KELEAIDRQYPFEPLKYLRNTLRLTFEEGIQMLKDAGVEIDPLGDLNTEAERKLGQLVLE
KYGTEFYILHRYPLAVRPFYTMPCYDNPTYSNSFDVFIRGEEIISGAQRVHVPEFLAERA
QACGIDVKTIETYIDSFRYGAPPHGGFGVGLERVVMLFCGLNNIRKTSLFPRDPQRIAP
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcttcatctgaaactcccatggacgagtcgctctctgccggcgtcagcaagaag
gctgctaagaaggaggctgctaagcaggagaagttgcgtcgtcgccaggaagcagctgct
gaagttgccatttcgtctcttgatgttgaggacgacccgctatcggctaactatggcgat
gttccactctccaacctccaatccaaagaggctaagaatatcgagaattggactcaggtt
ggctctttgacaggggagcttaaagataagtatgtgttgttgcgtggacgagttcagacg
attcgtgctgttgccaagaagatggcatttttggtagtgagagaaaagggattcactgtg
caatgtgttgtgtcagagcagccagagcttgtgagtcgccagatggttaagtatgtcgtt
ggattgagccgtgagtctattgttgacgttgaaggagtcgtgtctgtgcccaatgttgcc
attaaaggagctacacagcaggtggagattcaagtaaggaaagtatattgcatcagtaag
gcaatgccttctctgcctataaatattgaggacgccgctcgtagtgaagctgaaattgag
aaagcgttgcaggctggtgagcaactagtacgtgttaaccaggatacgcggttgaactac
agagtccttgacatacgaactcccgctaaccaaggaatttttcgaattcaatgtcaagtt
ggagctatatttagacaatttctgttgtctgaaggttttgttgaaattcatactccaaag
ttgattgggggatccagtgaaggtggtgcttctgtttttaggttggattacaaaggccag
cccgcttgtctggcgcagtcgccgcagctacataagcaaatggctatctgtggcgacttt
gggcgtgtatttgagatcggtcctgttttcagagcggaggattcttacacacataggcat
ctgtgtgaatttacgggacttgatgttgaaatggagatcaaaactcattattctgaggtc
atgaacatcgtggaccgtctgttcgtcaaaatgtttgacagtttgaatgaaaactgtatg
aaggagcttgaagctattgatagacagtatcctttcgaaccattgaagtacttgcgaaac
actctacgacttacgttcgaggaaggaattcagatgctgaaggatgccggtgtcgaaatt
gatcctcttggggatcttaatacagaggccgagaggaaattgggacagctcgtcttagag
aaatatggcacagagttctacattcttcaccgatatcctttggctgttaggccattctat
actatgccttgctatgataatccaacttatagtaactcattcgacgtcttcattagaggg
gaagaaatcatttccggggctcagcgtgttcatgtaccagaatttctggccgaacgtgct
caagcatgtgggatcgatgtaaaaaccatagaaacatacatcgattcgttcagatatggt
gctcctcctcatggtggattcggagtaggtttggagcgtgtcgtgatgcttttctgtggt
ttgaataacatccgcaaaacctcgttgttccctcgtgacccacaaaggatcgctccttag

DBGET integrated database retrieval system