KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111788163Help
Entry
111788163         CDS       T05351                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase CYP57
  KO
K12737  peptidyl-prolyl cis-trans isomerase SDCCAG10 [EC:5.2.1.8]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cpep03041]
    111788163
   03110 Chaperones and folding catalysts [BR:cpep03110]
    111788163
Enzymes [BR:cpep01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     111788163
Spliceosome [BR:cpep03041]
 Complex C
  Other components
   PPlases
    111788163
Chaperones and folding catalysts [BR:cpep03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    111788163
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 111788163
NCBI-ProteinID: XP_023524179
Position
LG02
AA seq 493 aa AA seqDB search
MSTVYVLEPPTRGKVVLNTTCGPLDIELWPKEAPKAVRNFVQLCLEGYYDSTIFHRIIKD
FIVQGGDPTGSGTGGESIYGGVFPDEFHSRLRFKHRGLVACANAGSPHSNGSQFFITLSR
CDDLDKKHTIFGKVTGDSIYNLTSLGEFETDKDDRPVDPPKIKSVEVLWNPFDDIVPRAP
AKPGIPSTVDSDNKDIKKKAVKKLNLLSFGEEAEEDEKELAAVKKKIKSSHDVLDDPRLL
KDVIPSSELDNKRTREMQLSVRETLASKKQESRRDSDAENSNLPQYSDSDDDEANFDARM
RQQILRKRTELGDAPSHHKSKNGTSDSKNNEGSTQRSSAENTNREQPKVEKLSMKKKGIG
SEARAERMANADSDLQLLGEAERGRQLQKLKKRRLQGREDEVLAKLANFKKAISGKPTTS
SAESEGGNDELSDWKSAGLKFTPEPGKDRMTRSDDPNDYVVHDPLLEKGKEKFNKMQAKQ
KRREREWAGKSLT
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactgtttacgtgctagagccgccgacgagggggaaggtcgtattgaatacgacg
tgtgggccgctcgacatcgagctatggcctaaggaagctccaaaagccgtcagaaatttc
gttcaactctgtctcgaaggctattacgatagtaccatctttcaccggatcatcaaggac
ttcattgttcagggcggcgatcctaccggcagtggcacaggtggtgaaagtatctatggg
ggtgttttcccagatgagtttcactcacggctaagattcaagcacaggggcttagtagca
tgtgcaaatgctgggtcacctcattcaaatggaagtcagttttttataaccttgagtcga
tgtgatgaccttgacaagaagcacactatttttggaaaggtcactggggattctatatat
aatctaacaagtttgggtgagtttgaaactgacaaggatgaccgtcctgtggatccaccc
aagattaaatcagtcgaggtattatggaatccatttgacgatatcgttccaagagcgcct
gcaaagcctgggatcccatccactgttgattctgacaacaaggacattaagaagaaagct
gtgaaaaaacttaatttactatcatttggagaagaagctgaagaagacgagaaagaactg
gcagctgtgaagaaaaaaattaagagcagtcatgatgtattggatgatccacgtctgctg
aaggacgtgattccaagcagtgaattggacaataaaagaacaagggagatgcagctatct
gttagagaaactttagcatcaaagaaacaagagtctcgtagagattcagatgctgaaaat
tctaacctccctcaatacagcgacagtgatgatgatgaagctaactttgatgcccgaatg
cgtcaacagatattaagaaaaagaacagagttgggagatgcaccatctcaccacaagtct
aaaaatgggacttctgactcgaagaataatgaaggatctactcaaaggtccagtgctgag
aacactaaccgtgagcaaccaaaggttgagaagttatctatgaagaaaaaaggaattgga
tctgaagcaagagcggagcgaatggctaatgctgactcggacttgcagttattgggtgaa
gctgaaagagggagacagctgcaaaaattgaagaagaggagactgcaaggacgtgaagat
gaagttttggccaaacttgcgaattttaagaaagccatttctggaaaaccaacaacttca
agcgccgaatctgagggtggcaatgatgagttgtcagactggaaatctgctgggttaaag
ttcacaccagaacctgggaaggaccgcatgactcgtagtgatgatccaaatgactatgtt
gtgcatgaccctcttctcgagaaggggaaagaaaaattcaacaaaatgcaagccaaacaa
aagcgacgcgagcgggaatgggctggcaaatctcttacttaa

DBGET integrated database retrieval system