KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111788175Help
Entry
111788175         CDS       T05351                                 

Definition
(RefSeq) rust resistance kinase Lr10-like
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cpep01001]
    111788175
Enzymes [BR:cpep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111788175
Protein kinases [BR:cpep01001]
 Serine/threonine kinases: TKL group
  IRAK family
   111788175
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Kinase-like ABC1 APH
Motif
Other DBs
NCBI-GeneID: 111788175
NCBI-ProteinID: XP_023524194
Position
LG02
AA seq 463 aa AA seqDB search
MIEIALLCQSDWMFSPPDSSFTSPEKAFNSMIILYVVGSVVSLLVFGVIGICLYKFVKKA
TPDVVRELRNITVAPPLAPAPHVSLPPPVIWEADAPTMEKFFREIAEEKPVRFTAPDLYS
FTSNYSTRLGSGGFGEVYKGQFPNGVNIAVKVLKKSSDKRAEEQFMAEVGSICRTYHINL
VRLYGFCYDHFMSALVFEYLENGSLDKYLFDRKQAMEWEKLHDIAIGTARGLAYLHEECQ
QRIIHYDIKPANILLDSNFFPKVGDFGLAKLCNRDNTHVSMSGFRGTYGYSAPEFFLTNY
RVSHKCDVYSFGMVLFEIVGRKRNASVTDSGNPDWFPEKVWDAFEKGVLDELVVGCGIGE
GDREKASRACVVALWCVQDAPDERPRMSAVVKMLEGGVDIVAPPKPFQYLNPMRMGSTSG
SSGSSEQTKSGSSQNSTATDTNSRWYRNTTTIMRKYEIQMASS
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaatagctctgttatgccaatccgattggatgttctccccaccagattcgtcg
tttactagccccgaaaaggcattcaattctatgattattctctatgtggtggggtcggtg
gtttcgttgttggtttttggagtgattggcatatgtctatacaagtttgtcaagaaagct
acaccagacgttgtaagagaattaaggaacataactgtagctcctcctcttgcacctgca
cctcatgtgtctcttcctccccctgttatctgggaagccgatgcaccaacaatggagaag
ttcttcagagagatagccgaagaaaaaccggtcagattcaccgctccagacctctattcc
ttcacaagcaactactccactcgcctcggctccggcggcttcggagaggtttacaaaggc
cagttccctaacggcgtcaacatcgccgttaaggtccttaagaaaagctcagacaaaaga
gctgaagaacagttcatggctgaggttggttccatttgcagaacttatcatatcaatttg
gttaggctttatgggttttgttatgaccatttcatgagtgcgcttgtttttgagtatctg
gaaaatgggtcattggataagtacttatttgacagaaaacaagccatggaatgggagaaa
ttgcatgatatagccattgggactgcaagagggcttgcttatttgcatgaggaatgtcaa
cagagaatcattcattatgacattaagccagccaatattcttcttgattccaactttttc
cccaaagttggtgattttgggcttgccaagctttgcaatagggacaacactcatgtgtcg
atgagcggctttcgaggtacttatggatactcggcgccggagtttttcctcacgaactac
cgcgtgtcgcataagtgcgatgtttatagctttggaatggtgttgtttgagatcgttgga
aggaagaggaatgctagtgtgactgattctgggaatcctgattggtttccggagaaggtg
tgggatgcttttgaaaagggtgtgttggatgagttggttgttgggtgtgggattggcgag
ggggatagggagaaggcgagccgggcgtgcgtggtggctctgtggtgcgtgcaggacgca
ccggatgagcggccgcggatgagtgcggtggtgaagatgttggaggggggagtggatatt
gtggcgccgcctaagccttttcagtatttgaatccaatgcgaatggggagcactagtggt
tcttcaggcagctcagaacaaaccaagtctggtagttcacagaactccacggctacggac
accaattctcgatggtatcggaacactacgacaatcatgaggaaatatgaaatacaaatg
gcttcttcttga

DBGET integrated database retrieval system