KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111788461Help
Entry
111788461         CDS       T05351                                 

Definition
(RefSeq) pyruvate decarboxylase 2-like
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Pathway
cpep00010  Glycolysis / Gluconeogenesis
cpep01100  Metabolic pathways
cpep01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111788461
Enzymes [BR:cpep01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     111788461
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C NIBRIN_BRCT_II
Motif
Other DBs
NCBI-GeneID: 111788461
NCBI-ProteinID: XP_023524562
Position
LG02
AA seq 587 aa AA seqDB search
MATATATGDLDSGKSATNDAVSPDATLGRHLARRLVQIGVSDVFTVPGDFNLTLLDHLIA
EPGLTNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIV
GGPNTNDFGTNRILHHTIGLFDFSQELRCFQTVTCFQAVINNMEEAHAQIDKAISTALAE
SKPVYISISCNLPGIPHPTFTRDPIPFSISPRLSNKMGLEAAVEATAAFLNKAVKPVMVG
GPKLRVAKATDALVELADASGYVLAVMPSAKGLVPEHHPHFIGTYWGAVSTAFCGEIVES
ADAYLFAGPIFNDYSSVGYSLLLKKEKAIIVEPDRVKIANGPTFGCVLMKDFLKELAKKV
KKNTTAYENYRRIFVTDGQPPKCKPNEPLRVNIMFQHIQKMLSADTAVISETGDSWFNCQ
KLKLPNGCGYEFQMQYGSIGWSVGATLGYAQSVPSKRVIACIGDGSFQVTAQDISTMIRC
EQKTIIFLINNGGYTIEVEIHDGPYNVIKNWNYTALVDAIHNGEGKCWTTKVRTEEELIE
AIKKATGDKSDSLCFIEVIVHKDDTSKELLEWGSRVCSANSRPPNPQ
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgccaccgccaccggagatcttgattccggcaagtctgccaccaacgacgca
gtatccccagatgccaccctgggccgccaccttgcacgccgcctggtccaaataggggtc
agcgatgtattcaccgtccccggtgacttcaacctgacccttctcgaccatctcattgct
gagccagggctcaccaacattggctgttgcaatgagctcaatgctgggtatgcagccgat
gggtatgcgaggagccgtggtgttggtgcttgtgttgtcacattcaccgttggagggcta
agcgttttgaacgccattgctggtgcttatagtgagaatcttcctgtgatttgtattgtt
ggtggcccaaataccaacgattttggaactaataggattcttcatcatactattggattg
tttgatttcagtcaagaactccgatgctttcaaaccgtgacatgttttcaggctgtgatt
aacaacatggaagaagctcatgctcaaattgacaaagccatttctacagccctagctgaa
agcaagcctgtctacatcagtatcagctgcaacttacccggcatccctcacccaactttc
actagagaccccattccattttctatatctcccaggttaagcaacaagatggggctcgaa
gccgcggtcgaggccacggcagccttcctcaacaaggcagtaaagccagtgatggtcggt
ggaccgaagctccgagtggcgaaggccaccgacgcgttagtagagctcgccgacgcctct
ggctatgtacttgctgtaatgccatcggcgaaaggcctggtgccggagcaccaccctcac
ttcatcggaacttactggggagctgtcagcactgccttctgcggggagatcgtcgaatcg
gccgacgcatatctcttcgccggccccattttcaacgactacagctccgttggttactcc
cttcttttgaagaaggagaaagcaatcattgttgagcccgaccgtgtcaagatcgctaac
ggcccgacatttgggtgtgttttaatgaaggattttcttaaagaacttgcaaagaaagtg
aagaagaacacaacagcgtacgagaattaccgccggatctttgtcactgatggccagccg
ccaaaatgcaaacctaatgagcctcttagagtcaatattatgttccaacatattcaaaag
atgctgtcggccgacacggcggtgatctccgagaccggagactcatggttcaactgccag
aaactcaagctcccaaatggttgtgggtatgaatttcaaatgcaatatggttcgatcgga
tggtcggttggcgcgacattgggatacgctcaatctgtgccgagtaagcgtgtaattgca
tgcatcggggatggaagctttcaggtaacagcacaggatatatcaacgatgattaggtgt
gagcaaaaaactataatcttcttaatcaataacggaggttacacaattgaagtcgagatc
cacgacggaccgtacaacgtaatcaagaattggaactacacggccctcgtagacgcaatc
cacaacggtgaagggaaatgttggacgacaaaggtgcgtactgaggaggagctgattgag
gcgatcaagaaggcgacaggagacaagagtgattcattgtgttttattgaagtgattgtt
cataaagatgatacgagcaaggagctgcttgagtggggctcaagggtttgttctgccaat
agtcgccctccaaatcctcagtag

DBGET integrated database retrieval system