KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111789148Help
Entry
111789148         CDS       T05351                                 

Definition
(RefSeq) uncharacterized protein LOC111789148
  KO
K15891  NAD+-dependent farnesol dehydrogenase [EC:1.1.1.354]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Pathway
cpep00900  Terpenoid backbone biosynthesis
cpep00909  Sesquiterpenoid and triterpenoid biosynthesis
cpep01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    111789148
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    111789148
Enzymes [BR:cpep01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.354  farnesol dehydrogenase (NAD+)
     111789148
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Epimerase 3Beta_HSD GDP_Man_Dehyd NAD_binding_10 NAD_binding_4 NmrA Polysacc_synt_2 RmlD_sub_bind adh_short DUF1463
Motif
Other DBs
NCBI-GeneID: 111789148
NCBI-ProteinID: XP_023525575
Position
LG02
AA seq 335 aa AA seqDB search
MKVLVTGASGYLGGRLCHALLNRGFSVRALVRPTSDLSSLPHDPSALELVYGDVTDYQSL
LDAFSGCHIVFHAAALVEPWIPDPSKFISVNVRGLKNVLQAVTETKTIEKIIYTSSFFAL
GSTDGYVADENQVHHEKFFCTEYEKSKAIADKIALQAASEGVPIVPVYPGVIYGSGKLTA
GNVIARMLIERFNWRLPGYIGQGSDRYSFSHVDDVVEGHIAAMQKGRVGERYLLTGENAS
FVDVFDTAAAITGTRRPMFNIPLWLIEAYGWVSVFISRITGKLPLISPPVVSVLRHQWAY
SCEKAKEELDYNPRSLKEGLEEMVPWLKSLGLIKY
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttcttgtaactggggcgtctggatatctgggcggaaggctgtgccatgcattg
ttgaaccgaggcttctccgttcgggcattggtccgtccgaccagtgacctctcatctctt
cctcatgatccttccgctcttgagctcgtctatggcgatgtcaccgactaccagtcgctc
ctagatgctttctccggctgccatatcgtattccacgcagccgcactagtcgagccctgg
attcctgatccatccaaattcatctcagtcaacgttcgagggttgaagaacgtgttgcaa
gcggttacagagacgaagacgatcgagaagataatttacacgtcgtcgttttttgcgctt
ggctctaccgatggatacgttgccgatgaaaaccaggtccatcacgagaagttcttttgt
acggagtacgagaaatcaaaggctattgctgacaagattgcattgcaagctgcatctgag
ggcgtcccgatagtgccggtttatcccggagttatctatggttctggaaagcttacggct
ggaaatgtcatcgcccgcatgctgatcgaacggttcaattggcgattgccgggttatata
ggccaaggaagcgataggtactcgtttagccatgtcgacgatgtggtagaagggcatatt
gcagcaatgcagaaaggtcgagtaggtgaaaggtatcttctaacaggagaaaatgcatca
tttgtagatgtttttgacacagctgcagccattactggtacaagaagaccaatgtttaac
attccattgtggttgatcgaagcatatggttgggtttcagtttttatctctcggatcact
gggaaacttcctctcatcagccccccggttgtgagtgttctgagacatcaatgggcatat
tcgtgcgagaaggcgaaagaagaactggattataaccccagaagcttgaaagaaggatta
gaagaaatggttccatggctaaagagcttgggtttgataaagtattaa

DBGET integrated database retrieval system