KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111789212Help
Entry
111789212         CDS       T05351                                 

Definition
(RefSeq) farnesyl pyrophosphate synthase 1-like isoform X1
  KO
K00787  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Pathway
cpep00900  Terpenoid backbone biosynthesis
cpep01100  Metabolic pathways
cpep01110  Biosynthesis of secondary metabolites
Module
cpep_M00366  C10-C20 isoprenoid biosynthesis, plants
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    111789212
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:cpep01006]
    111789212
Enzymes [BR:cpep01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     111789212
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     111789212
Prenyltransferases [BR:cpep01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   111789212
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-GeneID: 111789212
NCBI-ProteinID: XP_023525677
Position
LG02
AA seq 342 aa AA seqDB search
MGEFRSKFLEVYSLLKSELLHDSAFEFTHDSRQWVDRMLDYNVPGGKLNRGLSVIESYKL
LKQGEELSDDEVFLASALGWCIEWLQAYFLVLDDIMDNSVTRRGQPCWFRVPKVGMVAIN
DGIMLRNHVLRIIKNHFREKPYYVDLLDLFNEVEFQTASGQMIDLITTLEGEKDLWKYSL
PLHHRIVQYKTGYYSFYLPVACALLMAGENLDNHSDVKNILIDMGTYFQVQDDYLDCFGH
PDVIGKIGTDIEDFKCSWLVVKALELGDEQQKTLLHENYGKADEDCVAKVKDLYKALNLE
GVFAEYESKSYEKLIKAIEVHPSDAVQAVLKSFLAKIYKRQK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaattcaggtccaaattcttggaggtttactcattgttgaaatccgagctcctt
cacgactctgctttcgagttcactcacgattctcgccaatgggtcgaccggatgctcgat
tacaatgtgcctggaggaaagttgaacagaggactctccgtcattgaaagctataagtta
ctaaaacaaggggaagagcttagtgatgatgaagtgtttcttgcatctgcacttggttgg
tgcattgaatggcttcaagcatattttcttgttcttgacgatatcatggacaattccgtc
acacgacgtggtcaaccttgctggttcagggttccaaaggtcggtatggttgctataaac
gatggcataatgttacgaaaccatgtcctgaggatcatcaaaaatcatttcagagaaaag
ccttattacgtagatcttttggatttgttcaatgaggtggaatttcaaacagcctcagga
cagatgattgatttgattaccacactcgaaggagagaaagacctatggaagtactcgtta
cctcttcatcatcgcattgttcagtacaaaactggatattactcgttctaccttccggtt
gcatgtgcgttactaatggcaggtgaaaatttggacaatcatagtgatgtcaagaacatt
cttattgatatgggaacctatttccaagtgcaggatgattatctggattgttttggtcat
cctgatgtgatagggaagattggaacagatattgaagatttcaagtgttcttggttggtt
gtgaaagcactagaacttggtgatgagcaacagaagactttgctgcatgaaaactatggg
aaagcagatgaggattgtgtagccaaagtgaaagacttatataaagcccttaatctagag
ggtgtatttgccgaatacgagagcaaaagttacgagaagcttataaaagccattgaagtt
catccaagtgatgcagtacaagcagtgttgaaatctttccttgcaaagatatacaagagg
cagaaatag

DBGET integrated database retrieval system