KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111789828
Entry
111789828         CDS       T05351                                 

Definition
(RefSeq) delta(14)-sterol reductase-like
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Pathway
cpep00100  Steroid biosynthesis
cpep01100  Metabolic pathways
cpep01110  Biosynthesis of secondary metabolites
Module
cpep_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    111789828
Enzymes [BR:cpep01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     111789828
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 111789828
NCBI-ProteinID: XP_023526298
Position
LG03
AA seq 369 aa
MDLDSLLQVLIPSWEAVAILFIFFFYLAIAGSVLPGRIIPGVILSDRTRLQYRCNGLLSL
LLLVALLGIGVKMNYISPTAISDRGLELLSATFWFSVLATFLLCIAGYSSSSQSSSLKPR
ATGNFIHDWWFGIQLNPHFLGIDLKFFFVRAGMMGWLLINLSVLARSVLNATLSQSMILY
QTFCAIYVIDYFVHEEYMTSTWDIIAERLGFMLVFGDLVWIPFTFSIQGWWLLTNRAELT
TAATIANCLVFLIGYLVFRGSNKQKHMFKKNSKALIWGKPPKVVGGKLLASGYWGIARHC
NYLGDLLLALSFSLPCGISSPIPYFYPMYLLILLIWRERRDEARCAEKYKDIWAEYTKLV
PWRILPYVY
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggatctggattctcttcttcaagttctaataccctcatgggaagctgttgctatcctc
ttcatcttctttttttacctggcgattgctgggtctgttctacctggaagaattatccct
ggagtgattttgtcagatcgtactaggcttcagtatcgctgcaatggtctactctctcta
ctgctgcttgtcgcgcttcttgggattggtgttaaaatgaattacatttcgcccactgct
atatcagatagaggactggagctgctatcagcaaccttctggtttagtgtcctggcaaca
tttttgctctgtattgctggctacagttcaagtagtcaaagttcttctctaaagcctcgt
gccacgggaaattttattcatgattggtggtttggtatccagttgaatcctcactttttg
ggcattgacctcaaatttttctttgtgagagctggaatgatgggctggctacttattaat
ctatcagttcttgcaagaagtgttctgaatgccaccttgagccaatcgatgatcctctac
cagacattttgtgcgatatatgtcatcgactactttgttcacgaggagtacatgacctcc
acatgggacataattgctgagagattaggcttcatgctggtatttggggatcttgtttgg
attccttttacgtttagcattcagggttggtggcttttgacaaacagggcagagttaaca
acggctgctaccatagctaactgcttagttttcttaattggatatcttgtgtttagagga
tctaacaagcaaaaacacatgtttaaaaagaacagcaaagcgcttatatggggtaagcct
ccgaaagttgttggaggaaagttgcttgcttctggttattggggaattgctcggcactgt
aattaccttggagacttgttgcttgcactttctttcagcttaccttgtgggattagctcc
ccaattccatacttttatcccatgtatcttctcattctgctaatatggagagagagacga
gacgaagctcgttgtgccgagaaatataaagacatttgggcggagtacaccaaactcgtc
ccttggagaatattgccttatgtttattag

DBGET integrated database retrieval system