KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111790456Help
Entry
111790456         CDS       T05351                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP16-3, chloroplastic
  KO
K01802  peptidylprolyl isomerase [EC:5.2.1.8]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    111790456
Enzymes [BR:cpep01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     111790456
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C
Motif
Other DBs
NCBI-GeneID: 111790456
NCBI-ProteinID: XP_023527120
Position
LG03
AA seq 258 aa AA seqDB search
MGMPTGQLFKPKVQDFVIRFPTVPTPCSQFSMASSASSMLLPLGSASGIHQRISSDKIRP
LVVRCLNANINAKEWRMKEYGKELNLTRRREMIGLVCGMSSLVIDVLNAKAAGLPPEDKP
RLCDDACEKELENVPMVTTESGLQYKDIKVGGGPSPPVGFQVAANYVAMVPSGQIFDSSL
EKKQLYIFRVGSGQVIKGLDEGILSMKVGGTRRLYIPGSLAFPKGLTSAPGRPRVAPSSP
VVFDVSLEYIPGLEDDEE
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggggatgccaactgggcagctatttaaaccgaaggttcaagatttcgttatccgtttc
ccaacggtgccaacaccttgctctcaattttccatggcgtcttccgcctcctcaatgttg
ctcccgcttggttcagcttctggaatacaccaaagaatttccagtgataaaatacgacct
cttgttgtgcgctgcttgaatgccaatatcaatgcaaaagaatggcggatgaaagagtat
gggaaggaactcaatttgactagaagaagagagatgattggtttagtttgtggaatgtcc
agtctcgtgatagatgttctaaatgccaaggcagctggcttgcctccagaagacaagcca
agattatgtgacgatgcctgtgagaaagaacttgaaaatgttcctatggtcacgactgag
tctggtttgcagtacaaggacatcaaagttggtggaggccccagtccacctgttggattt
caggtggcggcaaattatgttgcaatggttccatctggacaaatttttgacagttcactt
gagaagaagcagctttacatttttcgcgttggatctggtcaagtgatcaaaggacttgat
gaagggattttaagcatgaaagttggtgggacgcgtcgactgtacattcctggatctttg
gcattcccaaaaggcctgacatcagctccaggaaggccaagggtagctccaagtagccct
gtggtatttgatgtcagtctggaatacataccaggccttgaagatgatgaagagtga

DBGET integrated database retrieval system