KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111790814Help
Entry
111790814         CDS       T05351                                 

Definition
(RefSeq) mannose-1-phosphate guanyltransferase alpha-like
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Pathway
cpep00051  Fructose and mannose metabolism
cpep00520  Amino sugar and nucleotide sugar metabolism
cpep01100  Metabolic pathways
cpep01110  Biosynthesis of secondary metabolites
Module
cpep_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    111790814
   00520 Amino sugar and nucleotide sugar metabolism
    111790814
Enzymes [BR:cpep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     111790814
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase Hexapep NTP_transf_3 Fucokinase
Motif
Other DBs
NCBI-GeneID: 111790814
NCBI-ProteinID: XP_023527646
Position
LG03
AA seq 414 aa AA seqDB search
MESSEKVVAVIMVGGPTKGTRFRPLSFNTPKPLFPLAGQPMVHHPISACKGITNLAQIFL
IGFYEERDFALYVSSLSNELRLPVRYLKEDKPHGSAGGIYYFRDIILEDSPSYMFLLNCD
VCCNFPLPDMLEAHKRSGGMGTILVKKVSAESANQFGALVADPVTNELLHYTEKPETFVS
DLINCGVYVFTSEIFDAIEDVSVHREGRANLQRISSFEALQSATRNLPTDFVRLDQDILS
PLAGKKRLYTYQTMEFWEQIKTPGMSLKCSALYLAQFQLTSPHLLATGNGTKSANIVGDV
YIHPSAKVHPTAKIGPNVSVSANVRVAAGVRLISCIILDDAEIMENAVVIHSIIGWKSSV
GKWSRVQANGDFNDKLGITILGEAVIVEDEVVVTNSIVLPNKTLNLSVAEEIIL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggagagctcggagaaagtggttgctgttatcatggtcggcggcccaaccaaaggcact
agatttcggcctctttcattcaatactccgaagcctctattccctctggctggccagccg
atggttcatcatcctatctctgcatgcaaagggataacaaatttagcacaaatttttctt
attggattttatgaggagagggacttcgctctttacgtttcttctttgtccaatgagttg
agactgcctgtgaggtacttgaaggaggataaaccccatggctcagctgggggtatttat
tacttcagagatattatcttggaagacagcccatcgtacatgtttttactaaactgtgat
gtttgctgcaattttcctcttccagacatgcttgaggcacataaaagatccggtgggatg
ggaaccatattagtcaaaaaggtttctgccgaatcggctaatcagtttggtgcactggtt
gctgatccagtcacaaatgagctgttgcattacacagagaaacccgagacttttgtgagt
gatttgatcaattgtggtgtatatgtatttacctcggaaatttttgatgccatcgaagat
gtctctgttcatcgggaaggcagagctaatctacaacgtatctccagctttgaagctcta
caatctgcaacaaggaaccttcctacggacttcgtaagattagatcaagatattttgtcg
ccccttgccggaaagaaacggttgtatacgtaccagaccatggaattttgggaacaaatc
aagactccagggatgtctttgaagtgttcggccctttatcttgcccagtttcaattaacc
tctccccatcttttggctactggaaatggtaccaagagtgctaatatcgttggcgatgtc
tacattcatccatctgcaaaagtacaccccactgcaaagattggccccaatgtctctgta
tctgctaacgttcgtgtggctgctggtgtgaggcttataagttgcatcatcttggatgat
gccgaaattatggaaaatgctgttgttatacattctattattggatggaaatcatcagtg
ggcaaatggtctcgtgtccaggcaaatggtgacttcaatgataagctcggaattacgatc
cttggagaagctgtgattgttgaagacgaagttgtggtgaccaatagcattgtgctccca
aacaagaccctcaaccttagcgttgctgaggagattattttataa

DBGET integrated database retrieval system