KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111792874Help
Entry
111792874         CDS       T05351                                 

Definition
(RefSeq) probable serine/threonine-protein kinase PBL7 isoform X1
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Brite
Enzymes [BR:cpep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111792874
Protein kinases [BR:cpep01001]
 Serine/threonine kinases: TKL group
  IRAK family
   111792874
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Kinase-like APH ABC1 CbtA Insulin_TMD Syndecan
Motif
Other DBs
NCBI-GeneID: 111792874
NCBI-ProteinID: XP_023530253
Position
LG04
AA seq 427 aa AA seqDB search
MEPNTSPPPKYHIHRHNYSNANHHHHHHRHRHHSAILSSNSFLIIISSIISIAILLAILL
LIFMLHRLKTPSNPATAAASTAAQSATFIPHTAIHFDSSPEVKGGGCLYGGNSGRIPQYR
IRGVQVFTYKELELATDNFNEANLIGNGRFGAVYRGVLGDGAVVAVKMLHTDGKHRERAF
RMEVDLLSRLHSPCLVELLGYCADQHHRLLIFEFMHNGTLHHHLHNPNTESKPLDWNTRL
RIALDCAKALEFLHEHAVPSVIHRNFKCTNVLLDQDFRAKVSDFSSAKMGSDKINGQIST
QVLGTTGYLAPEYASTGKLTTKSDVYSYGVVLLELLTGRVPVDIKRPQGEHVLVSWALPR
LTNREKVEKMIDPAIQGKYSKKDLIQVAAIAAMCVQPEADYRPLMTDVVQSLVPLVKNPS
SSSRFFK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggaacccaacacttcaccgccaccaaaataccatatccaccgccacaactattccaat
gccaaccaccaccaccaccaccaccgccaccgccaccacagtgccattctcagctccaac
tccttcctcatcatcatttcctccatcatttccatcgccattctcctcgccatcctcctc
ctcatcttcatgctccaccgtctcaaaaccccatcaaaccctgccaccgccgctgcctcc
accgccgcacaatccgccacattcatcccccacacagccatccattttgactccagccca
gaagtgaaagggggtggttgtttgtacggtgggaattcagggaggattcctcaatacaga
atcaggggagttcaggttttcacttacaaggagctggaattggccactgataattttaat
gaagccaatctcattgggaatggaagatttggagctgtttacagaggggttcttggagat
ggagccgtggttgctgttaaaatgctccacacagatggcaagcacagggaacgtgctttc
agaatggaggtggatctgctgagccgcttgcactctccttgtttggtggagttgcttggc
tactgcgctgaccaacaccataggctactgatatttgaatttatgcacaatggtactctc
catcatcatctacataatcccaacactgaatctaagccattggattggaatactagatta
aggatagcccttgattgtgccaaggcacttgagttcctccatgagcatgcagttccatct
gttatccatagaaacttcaagtgcaccaatgttctgctagatcaggattttcgagccaag
gtgtccgatttcagttcggccaagatgggctctgataagatcaatggtcaaatatctacg
caagtactcggaacaacaggatatcttgcaccagagtatgcttcaacaggtaaactcaca
acaaagtcagatgtgtatagctatggtgttgtgctgctagagcttttgacgggtcgagtg
ccagttgatatcaagcggccacagggcgagcacgttcttgtctcatgggctctcccaagg
ctaaccaatagagaaaaagtagagaaaatgatcgacccagccattcaaggaaaatactca
aagaaggatctaattcaggttgcagccattgcagcaatgtgcgtgcagcccgaagccgac
taccgacctctgatgaccgacgtcgtgcagtcactggttcctctcgttaagaacccatct
tcctcatctagattcttcaaatga

DBGET integrated database retrieval system