KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111793902Help
Entry
111793902         CDS       T05351                                 

Definition
(RefSeq) uncharacterized protein LOC111793902
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    111793902
Enzymes [BR:cpep01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     111793902
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-GeneID: 111793902
NCBI-ProteinID: XP_023531739
Position
LG04
AA seq 444 aa AA seqDB search
MVGDAHFVQTPPNSKKSKKKKKKRGGTKKKMTSEQTAAFKYVTEWVYLDQSNSLASTAAA
SVVDDFGVQKTLGKGGEKVVFDLHSHSKFSDGFLSPSKLLERAHGNGVKVLALTDHDTMS
GIPEAIEAARRFGIKIIPGVEISTIFSSGNSESEEPVHILAYYSSCGPAKIEKLEKFLEN
IREGRFLRAKNMVSKLNELKLPLKWDHVAKITGKGVAPGRLHVARAMVEAGYVENLKQAF
SRYLFDGGPAYSTGSEPCAEKAIQLIHETGGVAVLAHPWALKNPVAIIRRLKDAGLHGLE
VYRSDGKLAAYSDLADMNGLLKLGGSDFHGRGGNSESEVGSVNLPVLAMLDFLKVARPIW
CSAIRDILESYVEEPTDSNLAKITRFGRTRVLKGGSPPPSCVNDIIDHCLTSWLTNEEKQ
DAEFEAIRLKLSHISMKQQEVQVP
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggtgggcgacgcccactttgttcagacgccgcccaattccaagaaatccaagaagaag
aagaagaagcgaggcggcaccaagaagaagatgacttctgagcaaactgcggcgtttaag
tatgtcacggagtgggtttatttggatcaatctaattctcttgcctccactgctgcggcg
tctgttgtggacgattttggagttcagaaaactcttggcaaaggtggggagaaggtcgtc
tttgacttgcattcgcattccaaattcagtgatggatttctttccccttcgaagctgctg
gagcgagctcatggaaatggggtgaaagttcttgctttgacagatcatgatacaatgtct
ggtatcccggaggccatcgaagcagctcgtagatttggtatcaaaataattccgggtgtc
gaaatcagtacgatattctcttctggtaactcagaatcagaagaaccagtacacatcctt
gcatattacagcagctgtggaccagcaaagattgagaagttggagaagttcttagaaaat
ataagagaggggcggtttttgcgtgcaaagaacatggtgtcaaaactgaatgagctaaag
ctgcctcttaaatgggatcatgtggctaagattactggtaaaggagttgctcctgggaga
ctccatgtggctcgtgccatggttgaagcaggctatgtcgaaaatctaaaacaggcattt
tctcgttacctttttgatggtggaccggcttactcaacgggatcagagccctgtgcagag
aaagcaatacaattgatacacgaaacggggggtgtggctgtcctagctcatccatgggcc
ttgaagaatcctgttgctatcattagaagattgaaagatgccggtcttcacgggctggag
gtttaccggagcgatggaaaattagcagcgtacagtgacctagcagacatgaatggcctt
ctaaaacttggaggatcagattttcatggaagaggtggaaacagtgaatccgaagttgga
agtgtaaaccttcctgttcttgctatgcttgactttcttaaggtcgctcgaccaatttgg
tgcagtgccattcgagacattctcgagagttacgtcgaagagcctacagactcaaatcta
gcaaaaattaccagatttggaaggacccgggttttgaagggtggctccccaccgccgagc
tgcgtaaatgacatcatcgatcattgtttaacttcgtggctgacgaacgaagagaagcaa
gatgccgagtttgaagctatcagattaaagctctcccatatttcaatgaaacaacaagaa
gttcaggtgccttaa

DBGET integrated database retrieval system