KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111794831Help
Entry
111794831         CDS       T05351                                 

Definition
(RefSeq) probable mediator of RNA polymerase II transcription subunit 37c
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Pathway
cpep03040  Spliceosome
cpep04141  Protein processing in endoplasmic reticulum
cpep04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    111794831
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111794831
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111794831
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cpep01009]
    111794831
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cpep03041]
    111794831
   03009 Ribosome biogenesis [BR:cpep03009]
    111794831
   03110 Chaperones and folding catalysts [BR:cpep03110]
    111794831
   04131 Membrane trafficking [BR:cpep04131]
    111794831
   03051 Proteasome [BR:cpep03051]
    111794831
   03029 Mitochondrial biogenesis [BR:cpep03029]
    111794831
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cpep04147]
    111794831
Protein phosphatases and associated proteins [BR:cpep01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     111794831
Spliceosome [BR:cpep03041]
 Complex B
  Other components
   Prp19 complex
    111794831
 Complex C
   Prp19-CDC5 complex
    111794831
Ribosome biogenesis [BR:cpep03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    111794831
Chaperones and folding catalysts [BR:cpep03110]
 Heat shock proteins
  HSP70 / DNAK
   111794831
Membrane trafficking [BR:cpep04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    111794831
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    111794831
Proteasome [BR:cpep03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    111794831
Mitochondrial biogenesis [BR:cpep03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    111794831
Exosome [BR:cpep04147]
 Exosomal proteins
  Proteins found in most exosomes
   111794831
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 111794831
NCBI-ProteinID: XP_023532762
Position
LG01
AA seq 648 aa AA seqDB search
MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN
QVAMNPLNTVFDAKRLIGRRFTDPTVQNDMKMWPFKVIAGPGDKPMIVVNYKGEEKQFAA
EEISSMVLTKMREIAEAYLGSSVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
TAAAIAYGLDKKASSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
NRLVNHFVQEFKRKHKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFY
TTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFF
NGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI
PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI
TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKLVQEAEKFKAEDEEHKK
KVESKNALENYAYNMRNTIRDEKIGGKLAPADKKKIEDAVEQAIQWLDGNQLAESDEFED
KMKELESICNPIIAKMYQGGADMGGGAMDDDTPPSGGSGAGPKIEEVD
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atggcgggaaagggcgagggtccggccatcggtatcgatctcggtactacttattcctgt
gttggagtttggcagcacgatcgtgttgagattatcgccaatgatcaggggaatcggaca
acgccgtcgtatgttgctttcactgacagcgagcggcttatcggcgatgctgcgaagaac
caggttgccatgaatcctctcaacaccgtcttcgatgcgaagcggttgattggaaggaga
ttcaccgatcccacggtccagaacgatatgaaaatgtggccgttcaaggtcatcgccggt
ccaggtgacaaacccatgattgttgtcaactacaaaggcgaagagaagcagttcgctgct
gaggaaatttcatccatggtcctcacgaaaatgcgtgagatagcagaagcttatctcggt
tcctccgtgaagaatgctgtcgttactgtccctgcttatttcaatgactctcagcgtcag
gccaccaaagacgcaggtgtcattgccggcctcaatgttatgaggatcatcaatgagccc
actgcggcagctatcgcttatggactagacaagaaagcatccagtgttggcgaaaagaat
gtactcatatttgatttaggtggaggaacatttgatgtctctcttctcacaattgaggag
ggtattttcgaagtgaaggcaactgccggtgacacccatctcggaggtgaggacttcgac
aacagattggttaaccatttcgttcaggaattcaagaggaagcataagaaggacatcagt
ggaaatccaagggctctgaggagattgaggactgcttgtgaaagggcgaagagaaccctt
tcatccactgctcaaactacaatcgagattgattctttgtatgaaggaattgatttctac
acaaccatcactcgtgctagattcgaggagctcaacatggacctgttccgaaagtgtatg
gagccagttgagaagtgtctgagagatgcaaagatggacaaaagcagtgtccatgatgtt
gtccttgttggtggctctacgaggattcctaaggtgcagcagctactgcaggatttcttc
aatggcaaggagctctgcaagagtatcaatcctgacgaggcagttgcttatggggctgct
gttcaagctgctatcttgagtggtgagggaaatgagaaagtgcaggatcttcttcttttg
gatgtcactcctctgtctcttggcttggagactgctggaggtgtgatgacagttttgatc
ccaaggaacaccaccatacccacaaagaaggagcaagtattttccacatactcagacaac
cagcctggtgttcttattcaggtctatgagggtgagagaacaagaaccagagataacaac
ttgctgggcaagtttgaactttccggcattcctccagctccaagaggtgttcctcagatc
actgtttgcttcgacatcgacgccaacggtattctaaatgtttctgcagaggataaaaca
actggacagaagaacaagatcaccattaccaacgacaaaggaaggttgtccaaagaggag
attgaaaaactggttcaagaagcagagaagttcaaggcggaagatgaggaacacaagaag
aaagttgaatcaaagaatgctttagagaactatgcatacaatatgaggaacacaatcaga
gatgaaaagataggtggtaagcttgccccagcagacaagaagaagattgaagatgcagtt
gaacaggccattcaatggctagacggcaaccagcttgcagagtccgacgaatttgaggac
aaaatgaaagaactcgaatctatttgcaaccccatcatagccaagatgtatcaaggtggg
gctgacatgggcggcggcgcaatggacgatgatactcctccatcaggcggcagtggcgct
ggtcctaagattgaggaagttgattaa

DBGET integrated database retrieval system