KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111795533Help
Entry
111795533         CDS       T05351                                 

Definition
(RefSeq) acyl-coenzyme A oxidase 3, peroxisomal-like
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Pathway
cpep00071  Fatty acid degradation
cpep00592  alpha-Linolenic acid metabolism
cpep01040  Biosynthesis of unsaturated fatty acids
cpep01100  Metabolic pathways
cpep01110  Biosynthesis of secondary metabolites
cpep01212  Fatty acid metabolism
cpep04146  Peroxisome
Module
cpep_M00087  beta-Oxidation
cpep_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    111795533
   00592 alpha-Linolenic acid metabolism
    111795533
   01040 Biosynthesis of unsaturated fatty acids
    111795533
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    111795533
Enzymes [BR:cpep01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     111795533
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1
Motif
Other DBs
NCBI-GeneID: 111795533
NCBI-ProteinID: XP_023533782
Position
LG05
AA seq 671 aa AA seqDB search
MDRVSWRTQVLSNHLVHHQTTSDLSPNPCLEFSPPEISECFSFDIKQMRNLLDVHNLPDR
DWMFGVMMQSKLFNPVQSGGRVFVSPDYNQSMEQQREMTMKRIQYLLDNGVFKGWLTDNG
IEAAWRKFALFEAIGIYDHSLAIKIGVHVFLWGGAIQFFGTKRHHDAWLKITENYAIKGC
FAMTELGHGSNVRGIETVTKYDSSTGEFVINTPCESAQKYWIGGAAKHATHTIVFSQLHI
NGKNEGVHAFIAQIRDADGNICPQIRIADCGHKLGLNGVDNGRIWFDNVRIPRENLLNSV
ADVSVEGKYLSATNDPDKRFAAFMAPLTSGRVTISVAAIYSAKVGLAIAIRYSLTRRAFS
LTPNGPEIQLLDYPNHQKRLLPLLAKTYAMSFAANELKRIYMKRTPESIKTLHVVSSAFK
ATFTWHNMRTLQECREACGGQGIKSENRVGPLKSEFDVQSTFEGDNNVLMQQVSKALLSE
YIAAKKRNKPFKGMGLEHMNEACPVIPSKLTGPILRSSKFQTDAFCLRERDILNRLAAEV
SHHEAQGDSKEYAFIQSFLLAEDLGRAFSEKAILKSFMEVEDSVPSGPVKNVSGVLRSMY
ALICLEEDGSFLRYGYLSPENAGAVRQEVKKLCSEIRPHALALVSSFGIPDAFLAPIAYN
WVDSNSWPSVQ
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atggatcgtgtttcttggagaactcaggtgctttcgaatcaccttgttcatcaccaaact
acttcagatcttagccccaatccatgtctcgagttctcccctccggagatttccgaatgc
ttctccttcgatatcaaacagatgcggaacctcttggatgttcataaccttccggaccgg
gactggatgtttggggtgatgatgcagagcaagctgttcaatcccgtgcaatccggtggc
cgagtcttcgtttcccctgattataatcaatccatggagcagcagagggagatgacgatg
aagcggattcagtaccttttggataatggcgttttcaagggttggcttacagataatgga
attgaagccgcgtggagaaagtttgcgctgtttgaggcaattggaatttatgatcactct
ctagcgattaagattggtgttcatgtcttcctatggggtggagctatccaattctttggc
acaaagcgtcatcatgatgcatggttaaagatcacagaaaattatgcaatcaagggttgc
tttgcaatgactgagctcggtcatggaagtaatgttcgaggaattgaaacagtaacaaaa
tatgattcaagcaccggagaatttgttatcaatactccctgtgagtcagctcagaagtac
tggattggcggggcagccaagcatgcaacacatactatagtcttttcacagcttcacata
aatgggaaaaatgaaggcgtccatgcttttatagctcagatcagggatgcagatggtaat
atctgtccacaaatacgtatagctgattgtggccataagcttggcttgaacggtgttgat
aatggtcggatctggtttgataatgtgcgaattccaagagagaatttgttgaattctgta
gctgatgtatcagtagaagggaaatatctaagtgccacaaatgacccggacaagaggttt
gcagcgtttatggcacctttgacatctggtcgtgtaaccatttccgttgctgcaatttat
tccgcaaaggttggtttagcaattgctataagatactcattaacaaggagagccttttca
cttactcctaatggacctgaaatccaattgctggactaccctaatcatcaaaagagattg
ctgcctctccttgctaagacatatgccatgagttttgctgcaaatgaattgaaaaggatc
tacatgaagagaacaccagagtccatcaaaactctccatgttgtctcaagtgcatttaag
gctacctttacctggcataatatgaggacacttcaggaatgtcgtgaagcatgtggaggc
caaggcataaagtccgaaaatcgagttggtcctttgaaaagtgaatttgatgtccagtct
acttttgaaggcgataataatgtcctaatgcagcaggtgagcaaggcattgctgtccgag
tacattgcagctaagaagagaaacaaaccatttaaaggtatgggattagaacacatgaat
gaggcctgccctgtcattccttctaagcttactggtcctatccttagaagctctaaattc
cagacggacgccttttgcttaagagaacgagatatattaaaccgtttagctgctgaagta
tctcatcatgaagcacaaggtgatagcaaagaatatgccttcattcagagctttctgctt
gcagaagacttgggcagagctttctctgaaaaagccatattgaagtcttttatggaagtt
gaagatagtgtaccatcgggtccagtgaagaatgtttcaggtgttctgagatccatgtat
gcgttgatctgcttggaggaagatggttccttcctccgctatggttatttatcaccagaa
aatgcaggggcagtgaggcaggaagtgaagaaactatgcagcgaaatacgaccgcatgct
ctagcgctggtcagctcgttcggcatacccgacgctttcctggcccctatagcgtacaac
tgggtggactccaattcctggccttcggtgcagtaa

DBGET integrated database retrieval system