KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111796152Help
Entry
111796152         CDS       T05351                                 

Definition
(RefSeq) protein IWS1 homolog 1
  KO
K17498  transcription factor SPN1
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cpep03021]
    111796152
Transcription machinery [BR:cpep03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     111796152
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Med26 baeRF_family3
Motif
Other DBs
NCBI-GeneID: 111796152
NCBI-ProteinID: XP_023534636
Position
LG05
AA seq 505 aa AA seqDB search
MGYEDNPYRDEDGEPLMDFDHIQSDGEQSPEPYNPDELLDEDIADWGGRQRSQTPVYDAE
EPQARPRKRLIKKSLAGKETMPSNLVDDNDDAAGQFVREGSEERKRKKGISSGKMEKRFK
PEKKFGSGSGGKSRLSKKAFSGKGLKDQDGDVKEMWETIAGGGSDDDHEGTRTLDDDNFI
DDSGVDPADRYGSDDEPRSPRYAPEAEEGEEDDEINDLFKMGKKKKKNEKSPAEIALLVE
NVMAELEVTAEEDADLNRQGKPAVNKLKKLPLLTDVLSKKQLQQEFLDHGVLTLLKNWLE
PLPDGSLPNINIREAILKILTDFPIDLEQYDRREQLKKSGLGKVIMFLSKSDEETTSNRK
LAKDLVDQWSRPIFNKSTRFEDMRNVEDERVPYRRPMAKKSGNKVAGMESRDGDLDLDEF
SQGRKSGQSSSRQHASRPEATPLDFIVRPQSKIDPDEIRARAKQAVQDQRRIKMNKKLQQ
LKAPKKKQLQATKLSVEGRGMLKYL
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgggttacgaagacaatccgtaccgtgacgaggatggtgaaccattgatggactttgac
catatacagtcagacggtgagcaatcccctgaaccgtacaatcctgacgaactattagat
gaggatattgctgattggggcggacggcagcgatctcagactccggtctatgatgcggag
gagccccaggccaggcctaggaagaggttgatcaaaaagagtttggctggtaaggaaaca
atgccatccaatttggtggacgataatgatgatgcggcgggccagtttgtgagggaggga
tcggaggagaggaaaaggaagaaggggatcagtagtggaaaaatggagaagagattcaaa
cctgagaaaaaatttggaagtggtagcggaggcaagagtagattatccaagaaagccttc
tcagggaaagggttgaaggatcaagatggggatgtcaaggagatgtgggagactattgct
ggtggcggttctgatgatgaccatgagggtaccagaacattagatgatgataattttata
gatgatagtggtgtagatccagctgaccggtatggaagtgatgatgaaccacgttctccc
cgctatgctcctgaggcggaggaaggtgaggaagatgatgaaattaatgatctcttcaag
atgggtaagaagaagaagaagaatgagaaaagtcctgcggaaatagcattgcttgtggag
aatgtcatggccgagcttgaggtcacagccgaagaggatgcagaccttaacaggcagggg
aaacctgctgtcaataaactgaagaagctaccacttcttactgatgttctttcgaaaaag
cagcttcaacaagaattcttggatcatggagtgctaacccttctaaagaattggcttgaa
cctctgcccgatgggagtttgccgaatataaatatccgggaagcaatcttgaagattttg
actgattttcctatagatctagaacaatatgatagaagagagcagctgaagaagagtggc
cttgggaaggttattatgtttctatcaaaatctgatgaggaaaccacatccaatcggaaa
cttgcaaaagatttagtagatcaatggagtcgacccatatttaacaaaagtactagattt
gaggacatgagaaatgtggaagatgagagggtgccctatagaagacccatggcgaaaaag
tcgggaaacaaagttgctggaatggaatctcgagatggagatcttgacttggatgaattc
tcacaggggcgtaagtctggtcagtcgtcctcaaggcagcatgcttcacgacctgaagca
acaccattggattttattgtccgtccccaatctaagatagatccggatgaaatcagagct
cgtgctaagcaagccgtgcaagatcaacgtcgtatcaagatgaacaaaaagttgcagcag
ttgaaggctccaaagaagaagcagcttcaagcaacaaaacttagcgtcgaaggtcgcggt
atgctcaagtacttatga

DBGET integrated database retrieval system