KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111796540Help
Entry
111796540         CDS       T05351                                 

Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit C, chloroplastic/mitochondrial-like
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Pathway
cpep00970  Aminoacyl-tRNA biosynthesis
cpep01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    111796540
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cpep03029]
    111796540
Enzymes [BR:cpep01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     111796540
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     111796540
Mitochondrial biogenesis [BR:cpep03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    111796540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-GeneID: 111796540
NCBI-ProteinID: XP_023534971
Position
LG06
AA seq 145 aa AA seqDB search
MGSKSLPVLKGASSFSSLKRRIFISSGLHSPSVSNIRIRKCSTALGIMASLQPPDVLRLA
ETARISLTPGEVEELAPKIGQVVDWFGQLQTVDLQSMEPSIRADTGGVNQRNDAPETFEN
REAMIRAVPAFDEPYIKVPKVLNKD
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgggaagcaaatctcttcctgtgctcaaaggagcttcatcattttcatcgttaaagcgg
cgaatcttcatctctagcggcttgcattcgccatctgtttctaacatcagaatccgaaaa
tgttcgactgctttaggaattatggcctctcttcaacctcccgatgtcctccgtttagct
gaaacagctcgaatttctctcactcccggtgaggtagaagaattggcgcctaaaattgga
caagttgttgactggtttgggcagctccagacggttgatcttcaaagtatggaaccttcc
attagagcagatactggaggtgtcaatcagcggaatgacgctcctgaaacatttgaaaac
agagaggccatgattcgcgcagttccagcctttgatgagccgtatatcaaagttcctaaa
gttctcaataaggactag

DBGET integrated database retrieval system