KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111798017Help
Entry
111798017         CDS       T05351                                 

Definition
(RefSeq) erlin-2-B-like
  KO
K23341  erlin
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cpep04121]
    111798017
Ubiquitin system [BR:cpep04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ERAD complex
    111798017
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7
Motif
Other DBs
NCBI-GeneID: 111798017
NCBI-ProteinID: XP_023536725
Position
LG07
AA seq 366 aa AA seqDB search
MDRNQPLRPPSPQPRSSESGGSFSSVLTVFASFIAIFSMVLIPSQSNFKSNLSILHQVPE
GHVGVYWRGGALLKTITDPGFHLKLPLLTQFVPVQVTLQTDQVRDIPCGTKGGVMINFEK
IEVVNRLRKEYVHETLVHYGVNYDNIWIYDKIHHEINQFCSSHSLQQVYIDVFDQIDEKM
KDALQGDCTRYAPGIEIISVRVTKPTIPHSIRKNFEDMEVERTKVLIAIERQRVVEKEAE
TNKKMAISEAEKNANVSRILMEQKLMEKESSRRQQEIDNHIYLAREKSLADANYYRVLRE
AEANKLKLTPQFLELKFIEAIADNTKIFFGDKVPNMVLDQRLLGNFLHQVSEDASRKASG
DETLEI
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggatcgtaatcagccactgcgaccaccatctccgcagcctcgttcttcagaatccggc
ggcagtttctcatccgtactcactgttttcgcctccttcatcgccatattttccatggtg
ctgattccatctcaatcaaacttcaaaagtaacttatctattttacaccaagtaccagaa
ggtcatgtgggggtatattggagaggaggtgcccttctgaagacaataacggatccaggt
ttccatctaaagttgcctctgttaacccagtttgtgcctgttcaagtgaccctccagact
gatcaagttagggatattccatgtggtactaaggggggtgtaatgatcaacttcgagaaa
atcgaggttgtcaatcgcctccgcaaagaatatgtgcatgaaaccctggtccactatggt
gtgaattatgataacatatggatatatgacaagattcatcatgaaatcaatcagttttgt
agttctcacagtcttcagcaagtttatattgatgttttcgatcagattgatgaaaagatg
aaagatgccctccaaggtgactgtacacgttatgctccaggtattgaaataatcagtgtt
cgtgtaacaaagcccaccatcccacattctatcagaaagaactttgaagacatggaagtg
gagcgtacaaaggttttaattgctatagagagacaaagggtggtggagaaagaggcagaa
accaacaaaaaaatggcaatcagtgaagctgagaagaatgctaacgttagcaggatcctc
atggaacagaaactaatggagaaggagagttccaggaggcagcaagaaattgataaccac
atctatcttgctcgtgaaaaaagcctcgccgacgccaattattaccgtgttctaagagaa
gctgaagcgaacaagttgaagcttacaccccagtttcttgagcttaaattcatcgaggcc
attgctgataatacaaagattttttttggggacaaggttcccaacatggttttggatcag
aggttgctcggaaacttcctgcatcaggtttcagaagatgcatcaagaaaagcatccgga
gatgaaaccttagaaatatag

DBGET integrated database retrieval system