KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111798318Help
Entry
111798318         CDS       T05351                                 

Definition
(RefSeq) glutathione synthetase, chloroplastic-like
  KO
K21456  glutathione synthase [EC:6.3.2.3]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Pathway
cpep00270  Cysteine and methionine metabolism
cpep00480  Glutathione metabolism
cpep01100  Metabolic pathways
Module
cpep_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    111798318
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    111798318
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cpep04147]
    111798318
Enzymes [BR:cpep01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     111798318
Exosome [BR:cpep04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   111798318
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSH_synth_ATP GSH_synthase TetR_C_24 CPSF100_C
Motif
Other DBs
NCBI-GeneID: 111798318
NCBI-ProteinID: XP_023537150
Position
LG07
AA seq 295 aa AA seqDB search
MIPENYAGNQYAEALVKAWTEYNNPSAVIMIVVQAEERNMYDQHCLSVNLRKRHYVKTLR
KTLAEIDREGELQSDGTLLVDGQAVAVVYYRAGYTPTDYPSESEWKARLLVEQSSAVKCP
SISYHLVGTKKIQQELAQPNVLERFFDNKEDIAKIRKCFTGLWSLDDKDIVNKAIETPDL
FIMKPQREGGGNNIYGDDVRKTLVRLRKEGNVEDAAYILMQRIFPPVYPTIFVRDGICYK
DPAISELGIFGAYLRNKDKVIVNDQCGYLMTTKVSSSNEGGVAAGFAVLDSIYLT
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgattcctgaaaattatgcgggtaatcaatatgctgaggcattggtcaaagcttggact
gaatataacaacccaagtgctgttatcatgattgtggttcaagctgaggaacgcaacatg
tatgatcaacactgcctttctgttaacttgagaaaaagacattatgtcaaaactcttcgg
aaaacactggcagaaatcgatagggagggagaactgcaatctgatggaacactccttgta
gatggccaagcagttgcagttgtgtactacagggctggatatacacccactgactatcct
tctgaatcggaatggaaagcaaggttacttgtggagcagtcatctgcagtcaaatgccca
tccatatcttaccatttagtgggcaccaaaaaaattcaacaggaacttgcacaaccaaat
gtacttgaaaggttctttgacaataaagaggatattgccaagataaggaaatgttttaca
gggttgtggagtttagatgacaaagatatagtaaacaaagccatcgaaacaccagaccta
ttcattatgaagccgcaaagagaaggcggagggaacaatatctatggcgatgatgtgagg
aaaacccttgtaagattgcggaaggaagggaatgtagaagatgctgcttacattcttatg
cagaggatattcccacctgtttacccaacgatttttgttcgagatgggatttgttataag
gatcctgcaatttcagagcttggtatatttggcgcttacttaaggaacaaggacaaagta
attgtcaatgaccaatgtggttacctgatgacgaccaaagtatcttcatcaaatgagggt
ggggttgcagctggatttgctgttttggacagtatttacttaacttga

DBGET integrated database retrieval system