KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111800136Help
Entry
111800136         CDS       T05351                                 

Definition
(RefSeq) (-)-germacrene D synthase-like
  KO
K15803  (-)-germacrene D synthase [EC:4.2.3.75]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Pathway
cpep00909  Sesquiterpenoid and triterpenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    111800136
Enzymes [BR:cpep01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.75  (-)-germacrene D synthase
     111800136
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Terpene_synth_C Terpene_synth DnaB_2
Motif
Other DBs
NCBI-GeneID: 111800136
NCBI-ProteinID: XP_023539491
Position
LG08
AA seq 547 aa AA seqDB search
MASKDNTSLDDGVVPRRFANFPPSAWGDFFISYDSNTMLEEKMVEKQLQKLKEEVMNMFV
TTDKSSEKLRLIDSIQRLGLSHHFQLEINETLQLLQSSSDDDDDIYNIALKFRLLRQEGY
SISSEIFNKFINEEGEFKESIVKDKSGILSLYEASHLRMNGEYTLDKALRFTTTHLQEMA
MDESSPLVDEAKHALKWPIYKTVPRLMTKHYISVHQKDPPNSVLLTFAKLDYTTSQKLYQ
KELGQHARWWKQLNLIERLSFARDRAVESYFWALGVYYEPNYSVGRMILAKIIALATVLD
DMYDVYATLDELDLFTEAIERWDTNCMEKLPEYMKIFYEVILKTYEEFEEDMSKDIINYA
INYAKEAFKRQCRVYFMEAKWYHEGYVPSMEEYMKVSIVSTCYYLFAPISFLGMGVAASE
EAFKWVESDPMMLKASGIIGRLMNDITSHKFDQERGDVGSAVECYMKQHGVSEEETLVAL
ENEVVRAWKDVVEDYMKSSNISKEICMRVLNLARLSDRFYKEEDGYTFADGTTKCFIAST
LVDPVPI
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggcctcaaaagataatacctcactcgatgatggggttgttcctcgtcgatttgcaaac
tttccaccaagtgcatggggagatttcttcatttcctatgattccaacactatgctcgag
gagaagatggtcgagaaacagcttcaaaagcttaaagaagaagtgatgaacatgtttgtg
acaacagacaagtcttcggaaaaattaaggttgatagattcaattcaacgcttaggtttg
tcccatcactttcaactggaaattaatgaaacacttcaacttctgcaaagctcttccgac
gatgatgacgatatttacaatattgcccttaagtttcgattgcttagacaagaaggttat
tctatttcatctgagatattcaacaagtttataaatgaagagggagaattcaaagaatca
attgtgaaagacaaaagtggaatattaagtttgtacgaggcgtcccatttaagaatgaac
ggagagtatacattagataaagctttgaggttcacaactactcatcttcaagaaatggcc
atggatgagagctctcctttagtagatgaagccaagcatgctttgaagtggccaatctat
aaaactgtgccaaggcttatgaccaagcactacatttctgtccatcagaaggatccacca
aacagtgttttgctcacttttgcaaagttggattacaccacatctcaaaagctttatcag
aaagaactcggtcaacatgcgaggtggtggaagcagttgaatttaatagaaagactatct
tttgcacgagatcgggcagtggagagctacttttgggcgttgggagtgtactatgaaccc
aactactcggttggtagaatgatattagccaaaattattgctctagcaacggttctggat
gatatgtacgatgtatatgctacattggatgaacttgacctattcacagaggcaattgaa
aggtgggatactaactgcatggagaagctcccagagtacatgaagatattttatgaagtg
atattaaaaacctatgaagagtttgaggaagatatgagcaaggacatcattaactatgcc
attaattatgcaaaagaagcgtttaaaaggcagtgtagagtttattttatggaagctaaa
tggtaccatgaaggatatgtgccaagcatggaggagtacatgaaagtgtccattgtatcc
acttgttactatctttttgctccaatttcatttcttggtatgggcgttgctgcttctgaa
gaggctttcaaatgggttgagagtgatccaatgatgctcaaggcaagtggaataattggg
aggctcatgaatgacataacttcacacaagtttgaccaagagagaggggacgttgggtca
gcggttgaatgttacatgaagcaacatggagtatcagaagaagaaacgttggttgcattg
gaaaatgaagtagtaagagcatggaaagatgtagttgaagactatatgaaatcatccaac
atttcaaaggagatctgcatgcgtgtgttgaatcttgcacgcctctcagaccgcttttat
aaagaggaagatggttacacattcgctgatggaacaaccaaatgtttcattgcctctacc
cttgtcgaccccgtaccaatatga

DBGET integrated database retrieval system