KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111800712Help
Entry
111800712         CDS       T05351                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase kinase 1-like
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cpep01001]
    111800712
Enzymes [BR:cpep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     111800712
Protein kinases [BR:cpep01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   111800712
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Seadorna_VP7 APH Kdo
Motif
Other DBs
NCBI-GeneID: 111800712
NCBI-ProteinID: XP_023540292
Position
LG08
AA seq 277 aa AA seqDB search
MSDALRRDYQVNEEIGRGRFGTVFRCISRAFGGFYAVKSMDKRRISAGDSLDSECLVNET
KILHLLYPHPHILALHNLYEDEFHLHIVLDLCSSDLLRRINLQVFSEAEAALVMSQLMSA
LAHCHRHGVAHRDIKPDNILFDEWNSLKLADFGSVEMFKLGEESMSGVVGTPYYVAPEVL
AGKNYGEKVDVWSAGVVLYVMLAGFPPFQGESVVEIFHAVLRTNLRFPPRVFHSVSPMAK
DLLRKMLCKDVSRRLSAEQVLRHPWITAGGETGRQRN
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgcgttgaggagagactatcaagtgaacgaagagatcggccggggaagattc
ggcactgtttttcgatgtatttccagagcttttggtggattctatgctgttaaatccatg
gacaagaggcgaatctccgccggtgattcactcgactctgaatgtcttgtgaacgagacg
aagattcttcatctcctttatcctcatcctcacattcttgctttgcataatctctacgaa
gatgaatttcacctccatatagttctcgatctctgttcttccgatctccttcggcgaatt
aatctccaggttttttctgaggcggaggctgctttggttatgtcgcaactgatgagtgcg
ttggctcattgtcaccgtcacggcgttgcgcaccgtgatattaagccggataacattctg
tttgacgagtggaattcgttgaaactcgcggatttcggatcggttgagatgtttaagctg
ggagaagaatcgatgagcggagtcgtcggaacgccgtactacgtggcgccggaagtgctg
gctggaaaaaactacggcgagaaggtcgatgtgtggagcgccggtgtggttttgtacgtt
atgttggctggttttccgccgtttcagggagaatcggttgttgagatctttcatgcggtg
ttgcgaacgaatttgagatttccgcctagagttttccactccgtatcgcccatggcgaaa
gacttgcttcgaaaaatgctctgtaaagatgtttccaggagactctccgccgaacaagtc
ctcaggcatccatggataacagctgggggggaaacaggccggcaaaggaactag

DBGET integrated database retrieval system