KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111802423Help
Entry
111802423         CDS       T05351                                 

Definition
(RefSeq) succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Pathway
cpep00020  Citrate cycle (TCA cycle)
cpep00640  Propanoate metabolism
cpep01100  Metabolic pathways
cpep01110  Biosynthesis of secondary metabolites
cpep01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    111802423
   00640 Propanoate metabolism
    111802423
Enzymes [BR:cpep01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     111802423
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     111802423
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 111802423
NCBI-ProteinID: XP_023542541
Position
LG09
AA seq 343 aa AA seqDB search
MGCQAVAKLIGSAINRKASSSSSSSSSVFSQAASQIRHYAAAPPPPPAVFVDKNTRVICQ
GITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIYVP
PPFAAAAILEAMEAELDLVVCITEGVPQHDMVRVKAALNRQSKTRLIGPNCPGIIKPGEC
KIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIE
KFLADPQTEGIVLIGEIGGTAEEDAAALIKESGTEKPIVGFIAGLTAPPGRRMGHAGAIV
SGGKGTAQDKIKTLREAGVTVVQSPAKIGVAMLDVFKQRGLVS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgggttgtcaagccgttgccaagctcatagggtcggccattaatcgaaaagcttcttct
tcttcatcttcatcatcctctgtgttttcgcaggcggcgtcgcagattcggcattacgca
gctgcaccgccaccaccgccggcggtattcgtagataaaaacactcgcgtcatatgtcaa
gggatcactggtaaaaacggtaccttccacactgagcaggcaatcgaatatggcacgaaa
atggttggtggtgtaacgccaaagaagggtggaaccgaacacttgggacttcctgttttt
aacacagttgctgaagccaaagctgaaacgaaggccaatgcatcagtaatttatgtccct
ccgccgtttgctgcagcagctatcttggaggcgatggaagctgagctagatcttgtagtt
tgtataacggaaggggtcccacagcatgatatggtaagagttaaggctgctttaaacaga
caatctaaaactaggttgattggccctaactgccctggtattatcaagcctggagagtgt
aaaattggaattatgcctgggtacatccacaaacctgggcgcattggtattgtatcacga
tctggcaccttgacgtatgaagcagttttccaaactactgctgttggccttggacaatcc
acgtgcgtaggtattggaggggatcccttcaacgggacaaactttgttgattgcatcgag
aagttccttgctgatcctcagacagaaggtattgttctaattggagaaattggtgggact
gcggaagaggatgctgctgctttgataaaggaaagtgggactgagaagcctatcgttggc
ttcattgctggccttactgctcccccaggccgtcgcatgggtcatgctggagccattgtt
tcgggtggaaaaggtactgcccaagacaaaatcaagacactgcgagaagctggagtaaca
gtggtccagtcgcctgcgaaaattggcgttgcaatgcttgatgtcttcaaacagagaggc
ctcgtcagttaa

DBGET integrated database retrieval system