KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111803747Help
Entry
111803747         CDS       T05351                                 

Definition
(RefSeq) isocitrate dehydrogenase [NAD] catalytic subunit 5, mitochondrial-like
  KO
K00030  isocitrate dehydrogenase (NAD+) [EC:1.1.1.41]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Pathway
cpep00020  Citrate cycle (TCA cycle)
cpep01100  Metabolic pathways
cpep01110  Biosynthesis of secondary metabolites
cpep01200  Carbon metabolism
cpep01210  2-Oxocarboxylic acid metabolism
cpep01230  Biosynthesis of amino acids
Module
cpep_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    111803747
Enzymes [BR:cpep01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.41  isocitrate dehydrogenase (NAD+)
     111803747
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 111803747
NCBI-ProteinID: XP_023544050
Position
LG10
AA seq 372 aa AA seqDB search
MALQLLRRALGNQSGQIFSLSSNLSSSSPLSVRAFSSAASPIRATLFPGDGIGPEIAESV
KQVFRTADVPIEWEEHYVSDQIDPRTQSFLTWESLESVRRNGVGLKGPMATPIGKGHRSL
NLTLRKELNLYANVRPCYSLPGYKTRYDNVNLITIRENTEGEYSGLEHQVVRGVVESLKI
ITRQASLRVAEYAFHYAKAHGRDRVSAIHKANIMQKTDGLFLKCCREVAEKYPEIKYEEV
VIDNCCMMLVKNPSLFDVLVMPNLYGDIISDLCAGLIGGLGLTPSCNIGEGGIALAEAVH
GSAPDIAGKNLANPTALLLSSVTMLRHLELHDKADRIQDAVLNTIAEGKYRTADLGGSSS
TTEFTNAICDHI
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggcgttgcagctcctgagacgcgctctcggaaaccagtcgggtcagatcttctccctt
tcatctaaccttagctcttcctctccactctccgttagggctttctcttccgccgcttca
ccgatccgagccactctcttccccggcgatggtattggtcccgaaattgcggagtccgtc
aaacaggtattcagaactgctgatgtgcccatcgaatgggaagaacactatgtcagcgac
caaatagatccccgaactcaaagtttcctcacgtgggaaagcttagaatcagtgagacgt
aatggtgtgggcttgaaaggacccatggctacgccaattggaaaaggccatcgttctttg
aaccttaccttgaggaaggaacttaatttatatgctaatgtgaggccttgctacagccta
cctggttataaaacacgttatgataatgtaaatctgatcaccatccgtgagaacacagaa
ggggagtacagtggacttgaacatcaagtggttagaggtgtggttgaaagccttaagatc
attacccgtcaagcaagtttaagggtagcagaatatgcttttcactatgccaaagctcat
gggagggatagagtctctgcaattcacaaagccaatataatgcagaaaactgatggtctt
ttccttaagtgttgccgtgaagttgcagagaagtatcctgagataaagtacgaggaagtt
gtcattgataattgctgtatgatgcttgtgaagaatccatcactctttgatgtattggtt
atgccaaatctttatggtgacattattagtgatctctgtgctgggctgattggaggatta
gggttaacgccaagctgtaatattggtgagggaggtattgctcttgctgaggctgtgcat
ggttcggcaccagatattgctggaaagaatttggcaaatccaactgcattgcttttgagt
tctgtcacgatgcttcggcatttggagctccatgacaaagctgatcggatccaagatgcc
gtcctcaacaccattgcagaagggaagtatcgaacagctgaccttggcggttcatcatcg
actaccgagttcaccaatgcaatctgtgaccatatttga

DBGET integrated database retrieval system