KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111804045Help
Entry
111804045         CDS       T05351                                 

Definition
(RefSeq) cysteine-rich receptor-like protein kinase 29
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Stress-antifung Haspin_kinase ABC1 DUF4448
Motif
Other DBs
NCBI-GeneID: 111804045
NCBI-ProteinID: XP_023544482
Position
LG10
AA seq 654 aa AA seqDB search
MAFFLHFALFFFARICATQPVFVNHVCMYQVGNFTSNSTYKTNLDHVLSSIATAKDSGTG
FYNFSYGQSSELTNAMALCRGDTKPDVCRSCLNDSIYFLTRLCPKQKEGIGWYDNCMLRY
SSRRMFGTMEAEPMYIVLMNNDSVIKEDLFKHNLRTLLYSLKDDASSGDSLRKYAAGDIF
GEGLGRIYALLQCTPDLSQIECDACLDSAIQKIPACCSVAWRLFSPSCNVRYQMSPFFDT
LLASPPLPLVFVPSSNTMSSEDKKKNVVHTTIVIALPFVVVSVFTIGIYMFLRSRKLRGR
VETTDHDEISPVNFLQYDFKTIRDATDDFAISNKLGQGGFGAVYKGKLLNGQEVAVKRLA
QGSQQGDFEFKTEVSLVAKLQHRNLVRLLGFCFERNERLLIYELLLNSSLDRFIFDPVQR
QYLDWSRRYRIIVGISRGLVYLHEDSRFKVIHHDLKASNILLDAELNPKITDFGMARLCS
TDQSDGDTSKIKGTYGYMAPEYALYGHFSVKSDVFSFGVILLEIMSGQKNSCFQDGENTE
HLLSYTWKNWMEGNVGAIIDPILGRTCMDEMVRCIHLGLLCVQENVESRPTMASAVVMLN
SNSFTLPVPLRPGFLLQSNASNLPQHVDDYTEGSQHSLSESLYIEEESANQFIL
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atggcattctttcttcattttgccttgtttttctttgccagaatttgtgccactcagcca
gtctttgtcaaccatgtctgcatgtatcaagtagggaacttcaccagcaacagcacctac
aagaccaacctcgatcatgtactctcttccatcgccactgccaaagatagtggcactggc
ttttacaatttttcctatggtcaaagctcagaactaaccaatgccatggcgctctgccga
ggagatacgaagcctgatgtttgtcgaagctgcctcaacgactctatatattttctaaca
cggctatgtcctaagcagaaagaaggtattgggtggtatgataactgtatgttgcgctat
tcaagtcgtcgcatgtttggcacaatggaagctgaacccatgtacatagtgttgatgaac
aacgacagtgtcataaaggaagatctgttcaagcacaacctgaggacattgctgtatagc
ttgaaagatgatgcttcttcaggtgattctttacggaagtatgcagctggagatatattt
ggagaagggttggggaggatatatgcacttctgcagtgcacacctgatttgtctcaaatt
gaatgtgatgcttgcttagattcagcgatccaaaaaattccagcatgttgtagcgtagct
tggagacttttttcacccagctgtaacgttagatatcagatgtcccccttctttgatact
ctactggcttcaccaccactgccgctagtttttgttccatccagcaataccatgtcttca
gaagacaagaagaagaacgtcgtacacactaccattgtaatagctctaccgttcgtggtt
gtttcggttttcaccatcggcatctacatgtttttgagatccagaaagttgaggggaaga
gttgagactactgatcatgatgagattagccctgtgaatttcttgcaatatgatttcaag
acgattagagatgcaacagatgactttgctatctcaaataaacttggacaaggtggattt
ggtgctgtttataagggtaagcttttgaatggacaagaagtggctgtgaaaaggctagct
caaggttcgcaacagggtgacttcgaattcaaaactgaagtctcactggttgctaagcta
caacatcggaacctggttcgacttcttggcttttgctttgagagaaatgaaagactcctc
atctacgagctcttactgaactcaagcctagatcgtttcatatttgatccagttcaacgt
caatatttggactggtcgagacgttacagaattatagttggcatcagtcgtggactcgtg
tatttacacgaagattctcgattcaaagtcatccatcacgatcttaaagctagtaatatt
ttattagatgccgagctaaatccaaaaatcaccgattttggaatggcaagattgtgttca
actgatcaatcagatggtgatacaagtaaaatcaagggaacatacggatatatggctcca
gagtacgcgttgtacggacatttttcagtaaaatcagacgtgttcagttttggcgtaatt
ctgctagagatcatgagtggccaaaagaacagttgcttccaagatggagaaaacacagag
caccttctaagctacacatggaagaactggatggaagggaatgtcggggccatcatagac
ccgatattgggtagaacatgcatggatgaaatggtgagatgcatccatctaggattactg
tgtgttcaagaaaacgtagagagcagacccaccatggcttcagctgttgtcatgctcaat
agcaactccttcactcttcctgtacctttgcgccccggatttttgctgcagagcaatgcc
tcaaacttgccacagcatgttgatgattacacagaaggatcacagcatagtctgtcagag
agcctttatattgaagaagaatcagcaaaccaatttattctgtag

DBGET integrated database retrieval system