KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111804749Help
Entry
111804749         CDS       T05351                                 

Definition
(RefSeq) nicotianamine synthase-like
  KO
K05953  nicotianamine synthase [EC:2.5.1.43]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    111804749
Enzymes [BR:cpep01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.43  nicotianamine synthase
     111804749
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAS CheR Methyltransf_23
Motif
Other DBs
NCBI-GeneID: 111804749
NCBI-ProteinID: XP_023545298
Position
LG11
AA seq 326 aa AA seqDB search
MEGPLLREVCALYDQISSLASLKPSKNVDTLFTQLVLTCSPPAPGLDIASLPQPLQAMRA
HLIRLCATAEALLEVHFSSILASFENPIHNLSIFPYYSNYLKLSLLEFDILTSHCRRVPS
SVAFVGSGPLPLSSIVMASTHLKGTIFHNFDIDPAANTMAGQLVCSDSDLSKRMVFHTAD
VMEVTEAFGEYEVVFLAALVGLEEEEKGRVLRHLGKHMAPGAYLMLRSAHGARAFLYPVV
DVRDVEASGFEILSVFHPTDEVINSVVIARKVTDLVPDNDNYNDNDTDDEKRAVLVNAPI
ILAEKCSGFKDFGPMIEELAIEEQLS
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggaaggccctctgttgcgagaagtgtgcgccctgtacgaccaaatctcgagccttgct
agcctcaagccttccaaaaatgtcgacactctcttcacccaactagtcctcacgtgctcc
ccgcccgcccctggccttgatatcgcctctttgcctcagccacttcaagccatgagggct
catctcatccgtctctgcgccaccgctgaggcgcttcttgaagttcatttctcttccatt
ttggcttcctttgagaatcccattcataacttgtctatctttccttattactctaattac
ttgaagctctcgcttctcgagttcgatattcttacctctcattgtcgtcgggtgccctct
agcgttgcgttcgttggctctggccccctcccgctttcctccattgtcatggcgtccact
catcttaagggtactattttccacaactttgacatcgacccagctgcaaacaccatggcg
gggcaattggtttgttcggactcagatttatcgaagcggatggtgtttcacacggcagat
gtaatggaggtgacggaggcgtttggagagtacgaggtggtgtttttagcagcattggta
gggttggaggaggaagagaaagggagggttttgaggcatttagggaagcacatggcgccc
ggagcttatttgatgctaaggagtgcacatggagctagagcatttctctaccctgttgtc
gacgttcgtgacgtcgaagcatctgggttcgagattttgtccgtatttcaccctactgat
gaagttataaactccgttgttattgcaagaaaggtgactgatctcgttcctgacaacgat
aattataacgacaacgacacagatgatgaaaaacgagctgttttagttaacgcccctata
atattagccgagaagtgctcggggtttaaagacttcggtcccatgatcgaggagcttgcc
atagaagaacaactttcttga

DBGET integrated database retrieval system