KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111805544Help
Entry
111805544         CDS       T05351                                 

Definition
(RefSeq) alcohol dehydrogenase-like 7
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Pathway
cpep00010  Glycolysis / Gluconeogenesis
cpep00071  Fatty acid degradation
cpep00350  Tyrosine metabolism
cpep01100  Metabolic pathways
cpep01110  Biosynthesis of secondary metabolites
cpep01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111805544
  09103 Lipid metabolism
   00071 Fatty acid degradation
    111805544
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    111805544
Enzymes [BR:cpep01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     111805544
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     111805544
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C 2-Hacid_dh_C ADH_zinc_N_2 Methyltransf_31 UDPG_MGDP_dh_N TrkA_N F420_oxidored AlaDh_PNT_C
Motif
Other DBs
NCBI-GeneID: 111805544
NCBI-ProteinID: XP_023546421
Position
LG11
AA seq 382 aa AA seqDB search
MEDTAPPPTTGLQPIRCKAAVCRKAGEALVMEEIMVAPPMAHEVRIRIICTSLCYSDITV
WKMKLSWLCFEAIWVVESVGEDVNEVKEGDTVIPTFMADCGDCKDCLSNKSNLCSKLPFS
VSPGLPRCGTTRFTDLNGEVIHHFLFVSSFSEYTVVDVANVTKVDPAIPPNRACLLSCGV
STGVGAAWKTANVEKGSTVAIFGTGSIGLAVAEGARLCGAARIIGIDVNQDKFEIAKQFG
VTEFVNSRSLGDKSVSQVINEMTGGGADYCFECVGLPSLVQEAYACCRQGWGKTVVLGVH
KPGSVLSFDSLDVLHTGKTLVGSLFGGLKPKSDIPLLLQWYTDKELELDKFVTQEMSFED
INKAFTLLIEGKCLRCVMWMNK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggaagatacggcgccgccacccaccaccggacttcaacctatccgttgtaaagctgct
gtgtgtcggaaagcgggggaggcactagtgatggaggaaataatggtggcgccgccaatg
gctcatgaagttaggattaggataatatgcacctctttgtgttacagtgacattaccgtc
tggaagatgaagctctcatggctttgctttgaggccatttgggtggttgagagtgtaggg
gaggatgtgaacgaagttaaggaaggagatactgtcatcccaacattcatggctgactgt
ggggactgtaaagattgcttatcaaataagagcaatttatgttcaaagttgcctttcagt
gtgtctcctggactgccccgatgtgggacaaccagattcacagatctcaatggagaggtt
attcatcactttctgtttgtttcaagtttcagtgaatacaccgtggttgatgtcgccaat
gtaaccaaagttgatcctgctatccctccaaatagggcatgcctcctcagctgtggggta
tcaacaggggttggtgcagcatggaaaacagcaaatgtggagaagggatccaccgttgcc
atatttggaacagggtccattggtttagctgtcgctgaaggagcaagactatgtggagca
gccaggattattgggatagatgtcaaccaagataaatttgaaattgcgaaacagttcgga
gtcactgagtttgtcaattctagaagcttgggcgataaatcagtaagccaggtgattaat
gaaatgaccggtggtggagcagactattgctttgaatgtgttgggttgccttccttagtt
caagaggcatatgcatgttgcagacagggatggggaaaaacagtcgtgttaggagtgcac
aaaccaggatcggtgttgagttttgactcgttggatgttcttcatacgggaaagactctt
gtaggatcattgtttggaggattaaagccaaaatctgatattcctcttctccttcaatgg
tacacagataaggaacttgagctggataaatttgtgacccaagaaatgagttttgaagac
atcaacaaagctttcactttgctcattgaaggaaagtgtttgagatgtgtgatgtggatg
aacaaatga

DBGET integrated database retrieval system