KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111805580Help
Entry
111805580         CDS       T05351                                 

Definition
(RefSeq) proline-rich receptor-like protein kinase PERK3
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase ABC1 Nitrate_red_gam
Motif
Other DBs
NCBI-GeneID: 111805580
NCBI-ProteinID: XP_023546465
Position
LG01
AA seq 380 aa AA seqDB search
MSRILAAILGGSAGAVALVGLIIVLIRFLARSRNATRTSETGSSDPSIQVGRHVGIELSL
RDARRFEMAELALATNDFSDKNLIAEGKFGEVYKGMLHNGMFVAIKKRHGAPSQDFVDEV
HYLSSIRHRNFVTLLGYCQENNLQFLIFDYIPNGSVSSHLYGTEQRSAERLEFKIRLAIA
LGAAKGLSHLHSITPRLIHKNFKTSNVLVDENFIAKVADAGLHNVMGRSSISESSSRATT
DEIFLAPEVKEFRQFSEKSDVYSFGVFLLELLSGQKASDAPVSNPNYTLVDWIQSNPKKN
DIGSVMDPRLGKKSFTEEGMGEVMHLIAQCVGYSSERRPVMSYVVMELERILEKEMNLTT
VMGEGSPTVTLGSQLFKATK
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaggatcctagcagcaatattaggaggttctgcaggagctgtggcattggtggga
ttgattattgtgcttataagattcttagctcgctcgagaaacgctacaagaacatcggag
actggctcttcggatccttctattcaagtgggaagacatgtcgggatcgagttgtctcta
cgggatgctaggcgtttcgagatggcagagttggcgttagccactaatgatttcagcgac
aagaacttgattgctgaagggaagttcggggaggtctataaaggcatgcttcacaatggg
atgttcgtcgctatcaaaaaacggcacggagcgcctagccaggactttgtggatgaggta
cactacctctcgtctattcgacatcgaaatttcgtaactcttttaggctactgccaggaa
aacaatctacagtttctcatcttcgattacataccgaacggaagcgtttctagccactta
tatggcaccgagcagcgttcggctgagaggctcgaattcaagatcagactcgcaatagct
ctgggggcagctaaaggtctgtcgcatcttcactccattaccccgcgtttgatacacaaa
aactttaagacgtccaacgtactcgtagacgagaactttatagctaaagtggccgatgca
ggacttcacaatgtcatgggacgatctagcatttcagaatcatcgtctcgagcaacaacg
gatgagatattcctcgctcccgaggtaaaagagtttcgacaattctctgaaaagagcgac
gtatatagtttcggcgtattccttttggagttgttaagcggtcaaaaagcgtcggatgca
cctgtttccaatccaaattatactctggttgattggatacaaagcaatccgaaaaagaac
gatattggtagcgttatggatccgagattggggaagaagagcttcacggaggaaggtatg
ggtgaagtgatgcatttgatcgctcaatgcgtcgggtactcgagcgagaggcggccggtg
atgagctatgtggtgatggagcttgaaaggatactggagaaggagatgaacttgacaaca
gtgatgggagaagggagtccaacggttactcttggaagtcagttgttcaaagccacaaag
taa

DBGET integrated database retrieval system