KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111805900Help
Entry
111805900         CDS       T05351                                 

Definition
(RefSeq) equilibrative nucleotide transporter 1-like
  KO
K15014  solute carrier family 29 (equilibrative nucleoside transporter), member 1/2/3
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cpep02000]
    111805900
Transporters [BR:cpep02000]
 Solute carrier family (SLC)
  SLC29: Facilitative nucleoside transporter
   111805900
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nucleoside_tran
Motif
Other DBs
NCBI-GeneID: 111805900
NCBI-ProteinID: XP_023546954
Position
LG11
AA seq 418 aa AA seqDB search
MGLADGDSESTSLLETTSVAATPNKVPKDSFHLAYIIYFTLGFGYLLPWNAFVTAIDYFS
YLYPDASVDRIFAVVYMGVSFICLVFIILYSHKSNAHLRINLGLVLFVLTLLVVPVMDVV
YIQGRVGLYEGFYVTIGSVVLCGAADAVVQGGVIGSAGELPERYMQAVVAGTAGSGVLVS
FLRILTKSIYPQDASGLRESAKLYFAVSIVVMVICTILYNVVEKLPVVKYYKDLKAEATN
MEEEEKGPLTGMVWRSTLWQIVERIKWYGFGILLIYIVTLSIFPGYITEDVHSSILKDWY
PILLITGYNVFDLVGKSLTSVYVIQNPKIVIGGCAVRLLFFPLFFACLHGPLVFRTEIPV
TVLTCLMGLTNGYLTSVLMMLAPKIVQLQHAETAGVVMVLFLVTGLAAGSVLSWFWII
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgggtctcgccgatggagattcggaatcgacctctcttctggagactacatccgtcgct
gcgacacccaataaggttcccaaagattcattccatttggcctatataatctactttacc
ttgggctttggttacctccttccgtggaacgcttttgtcacggctattgactacttctcc
tatctctacccagatgcaagcgtcgatcgcatctttgctgttgtttacatgggggtttcc
ttcatttgcctcgtcttcattatcttgtattcccacaagtctaacgcacatttaaggatc
aacctgggtttggtcctttttgtgctgaccctgcttgtggttccagttatggacgtggtt
tacattcagggccgggtcgggttgtacgaggggttctatgtgaccatcggatcggtggtc
ttgtgtggagctgctgatgccgtcgtgcagggtggggtgattggctctgctggtgagctg
ccggagaggtacatgcaggctgttgtggctggcaccgccggttccggggtccttgtttct
ttcttgaggattctaaccaaatcaatatacccacaagatgcgagtgggctgagagaaagt
gcaaagctttacttcgccgtttccattgtagtgatggttatatgtacaatattgtacaat
gtggttgaaaagctacctgtggtgaagtattacaaggacttgaaggcagaagctacaaac
atggaggaagaggaaaaagggcctctgactgggatggtatggagatcaacgctgtggcag
atagtagagaggatcaagtggtacggctttgggattctccttatctacatagtaactttg
tcaatatttccaggatacattactgaggatgttcattcttccattctcaaagactggtac
ccgattctccttattactggctacaacgtgttcgatcttgtgggcaagtccctcacttca
gtttatgttattcaaaatcccaagattgttattggtggatgtgccgtgagactcttgttc
tttccactcttctttgcgtgtcttcacggtcctctagtcttcagaactgagattccagtg
acggtgctgacttgcctgatgggtcttactaatggctatttgacaagtgttctcatgatg
ttggctccaaagattgtccagttgcaacacgcagaaaccgcaggagttgtcatggttctg
ttcttggtcaccggtttggcggccggttctgttctgtcttggttttggatcatctag

DBGET integrated database retrieval system