KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111806614Help
Entry
111806614         CDS       T05351                                 

Definition
(RefSeq) U-box domain-containing protein 52-like
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Usp DUF218 APH
Motif
Other DBs
NCBI-GeneID: 111806614
NCBI-ProteinID: XP_023547757
Position
LG12
AA seq 721 aa AA seqDB search
MAAPTAEEEVNDSFTTSHTVIAISRDKNSQYAVKWAVENLFNRKNSGDCILIHVRSQSMH
PQDADTVPKEYRPPTEAELHQFFLPFRGFCARKGIVAKEIIIHDIDVPSALIDYVSKHSI
SNIVVGASHRNVILRKFKHPDVPTCLLKSTPESCSVYVIGRGKVHTKRLKKKPKSQTDGT
ETPPRAPHLSRSLSKIQKSSYSNISGLSEDKSSSGTSYDSMSGISDHSGPFKSFETSFEN
LESFTSSETNSRSFVSSNTPSSIEAEMRKLRLELKQTMEMYELASNEAIIAKQEAKEMQQ
LKMEMVEDQKIERGKSSEEAITTLAEFEKQKNKAATEAAVMAQKLAELETQKKRAIVENK
ARIEAEEMKKAIDLLERSNVCYKRYRIDEIEAATDHFNESNKIGEGGYGPVYQAILDHTS
VAIKILRPDRSHGQKQFQQEIEVLSRMRHPHMVLLLGACPENGCLIYEYMENGSLEDRLF
RKDNTPPIPWSTRFRIAADIATALLFLHQMKPEPVVHRDLKPANILLDHNYVGKIGDVGL
ARLVPPSVADSVTQYHMTAAAGTFCYIDPEYQQTGMLGVKSDIYSFGVLLLQLITARSPM
GLSYQVEEAIEHGTFPQVLDPTVTDWPIEDTLGLAQLALQCCELRKRDRPDLHTVLLPEL
VRLKNLGLSKMPPKGKLPDVCESRDRPASNSNSAPKLRRSGHEERTRNKPNLPMETRYRT
M
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atggcagctcccacggctgaagaagaagttaacgattcctttaccacttcccacacggtg
atcgccattagcagggacaagaacagtcaatatgcggttaaatgggctgtagaaaacctg
ttcaacaggaagaactccggcgattgcatcctcatccatgttcgtagccagagcatgcat
ccccaggatgcggatacggttcctaaggagtatcgtccaccgactgaagctgagttgcat
cagttcttccttcccttccgcggattctgtgcacgaaaaggaatagttgcaaaggagata
atcatacacgacattgatgttcctagtgcacttattgactatgtcagtaaacactccatt
agcaatattgttgtgggtgcttcccaccggaatgttattttgaggaagttcaagcatccc
gatgtcccaacgtgcttactcaaatcaactccagaatcgtgctctgtatatgtcataggt
agaggaaaagttcatactaagagactgaaaaagaaaccgaagtcacaaactgatggtaca
gaaacaccacctagggctccacatttgagcaggtctctatcaaaaatacaaaaatcatca
tactctaatatctcaggactctctgaagataaaagcagttctggcaccagttatgattca
atgtcaggcatcagtgaccattcggggcctttcaaatcgtttgaaacatcctttgagaac
ttagaatctttcacctcctcagagactaattcgaggagctttgtgtcctctaacacccca
tcttccatagaagctgagatgagaaagttgaggttggaactcaaacaaacaatggaaatg
tatgaattagcttccaatgaagctataatagcaaaacaagaggcaaaagaaatgcaacaa
ttgaagatggaaatggtagaagaccaaaaaattgagcgtggtaaatcttcagaagaggct
ataacaacattggccgagtttgagaagcagaagaacaaggctgcgacagaagcagctgta
atggcacagaagttggcagaattagagacccagaaaaaacgagctattgttgaaaataaa
gctaggattgaggcagaggagatgaagaaagcaattgatttattggaacgcagtaatgtc
tgctataaacgatacagaattgacgagatcgaagctgcaacagatcattttaatgagtct
aataagattggtgaagggggatatggacctgtttaccaagccatactcgatcatacttct
gttgccattaagatcttgagaccagatagatctcatgggcagaaacaattccagcaagag
attgaggttctaagccgcatgaggcatccacacatggttctcctcttaggtgcctgccca
gaaaacggttgcctcatttatgaatatatggaaaacgggagcttagaagaccgtcttttc
cgaaaggataacactcctccaatcccttggagtacccgtttcaggatagctgctgacatt
gccactgccttactcttccttcaccaaatgaagccagaacctgtggtgcatcgcgatctc
aagccagccaacattctcttagatcacaactacgtgggcaaaataggtgatgtgggtttg
gccaggctagttccaccatcggttgccgatagcgtcactcaatatcacatgactgctgca
gctggaacattctgttacattgatccagaatatcaacaaacaggaatgttgggtgtgaag
tcagatatttactcatttggtgttctgctactccagctcatcactgcaaggtcaccgatg
ggtctttcatatcaggtcgaggaggccattgaacacggcacatttccacaggtacttgat
cctacagttacagattggcctattgaagatactcttggactcgctcaattagctctgcag
tgctgtgagctaaggaaaagagacaggcctgatctccatacagttctattgcccgaactg
gtccggttaaaaaatctaggattgagcaaaatgccaccaaagggaaaactcccagatgtc
tgcgaatcacgtgatcgaccggcctctaactctaactcagctccaaaattaaggagatca
ggacatgaggaaagaacgagaaacaaacccaacctgccaatggaaactcgatatagaacg
atgtga

DBGET integrated database retrieval system