KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111806819Help
Entry
111806819         CDS       T05351                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: serine decarboxylase
  KO
K01590  histidine decarboxylase [EC:4.1.1.22]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Pathway
cpep00340  Histidine metabolism
cpep01100  Metabolic pathways
cpep01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    111806819
Enzymes [BR:cpep01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.22  histidine decarboxylase
     111806819
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC LssY_C
Motif
Other DBs
NCBI-GeneID: 111806819
NCBI-ProteinID: XP_023548071
Position
LG01
AA seq 480 aa AA seqDB search
MVGSAMGMSEKNGEAEILIGDLDPSGLFLESLTNGMDLDGEHHAELKQNGKREIVLGRNV
HTTCFTITEPDANDESTGDKDAYMASVLARYRKNLVERTKHHLGYPYNLDFDYGALGQLQ
HFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWEIEKNDYWGYITNCGTEGNLHGILV
GLWXIXDGILYASQESHYSVFKAARMYRMDCVKVGTLISGEIDCADLKLKLLANKDKPAI
LNVNIGTTVKGAVDDLDLVIQTLNECGFSNDRFYIHCDGALFGLMMPFVKRAPKVSFKKP
IGSVSVSGHKFIGCPMPCGVQLTRLEHINALSRNVEYLASRDATIMGSRNGHAPIFLWYT
LNRKGYTGFQKEVQKCLRNAHYLKGRLLDAGISAMLNELSSTVVFERPRDEEFVRRWQLA
CEGNIAHVVVMPNVIQEKLDDFIAELTEKRSTWYAEDKDQPPCLAAELGKENCACKLHRT
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggttggcagcgcgatggggatgagtgagaagaacggtgaggctgagattttgatcgga
gatttggatcccagtggtctttttttggagtctctgaccaacggcatggatctcgatgga
gaacatcatgcggaattgaaacagaatgggaagagggagattgtgctcggtagaaatgtc
cacactacttgtttcaccatcaccgagccagatgccaatgatgaatccactggtgacaag
gatgcttacatggctagtgtgttggctcgctatagaaagaatctcgtcgagaggactaag
catcatttaggttacccttataatttggacttcgattacggtgctctgggtcagttgcag
catttctcgattaacaatctcggcgatccgttcattgaaagcaattacggtgtgcactcg
aggcagtttgaggttggggttttggattggtttgctcgtctttgggagattgagaaaaat
gactattggggttacattacaaattgtggcacagaaggcaaccttcatgggattctcgtc
gggttatggtgaattncagatgggattctatatgcttctcaggaatctcattattccgtt
tttaaagcggctagaatgtatagaatggactgtgtgaaggttggaactctgatatctggt
gagatcgattgtgctgaccttaaactcaagttgcttgctaacaaagacaagccagctata
ctcaatgtcaatattggaaccactgtgaaaggagccgtggatgatcttgatcttgtgata
caaacactcaacgaatgtggattctcaaatgatcggttctatattcattgtgatggggca
ttgtttggacttatgatgccttttgtcaaacgtgcaccaaaggtctcgtttaagaagccc
attggaagtgttagtgtttcaggtcacaagttcattggatgtccaatgccttgtggtgtt
cagcttacaaggttggagcatataaatgccctctcaaggaatgttgagtatctagcctca
agggatgccacaatcatgggaagccggaatggccatgctcctatcttcctttggtacacc
ctcaacagaaaaggctatacaggatttcaaaaggaagttcagaagtgtctcagaaatgca
cactacctgaaaggccggcttcttgacgcaggaattagcgcaatgctgaatgaacttagc
agcaccgttgtgtttgaacgaccccgagatgaagagtttgttcgtaggtggcagcttgca
tgcgaaggaaatattgctcatgttgtggtaatgcccaatgttatccaagagaagctggat
gatttcatagcagaattgaccgaaaaacgctcaacctggtatgctgaagacaaagatcaa
cctccttgcctcgcagcagagttgggaaaggaaaactgtgcctgtaagttgcacaggact
tga

DBGET integrated database retrieval system