KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111807186Help
Entry
111807186         CDS       T05351                                 

Definition
(RefSeq) GPI transamidase component PIG-T isoform X1
  KO
K05292  GPI-anchor transamidase subunit T
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Pathway
cpep00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
cpep01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    111807186
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 111807186
NCBI-ProteinID: XP_023548556
Position
LG12
AA seq 669 aa AA seqDB search
MASFLRLISLLCLPILFAVPAIGSVSEGTEEDFSEDLLLKPLPDRKVLAHFHFQSRAPSS
RSNSYGRHHHLFPKAISQLVHKYRIKEMELSFTQGRWRYDRWGGFDSISSSNAKPSGVEL
WAVFDVPPNEVDASWKNLTHSLSGLFCASINFLESSTSYSAPKWGFRPASENMRYGTLPR
EAVCTENLTPWLKLLPCRDKSGLSVLMDRPSIYKGFYHSQRLHLLSTEFDSNAVDSAIVL
DQTLTVVLQPYSHRGALGYSNAAQLQPSWSLSSIFGRKVPGRCVLARSSNVYIQLDKGLM
AELQGMLGEQEMLAVTRSSSEGSIRNLAFELSANPDRVHMEMSSRDDKHLSVLYMFSVAE
KYDESEPLDLRFTWKIPVVWSIPQAPLHVTRFVLGSGNERGAIALQLKSTKPSDQLIPNT
VITDSCSLLVKVFQVVPWYIKVYYHTLQVFIDDQPHSITNVVEKMQVSPSEDKVSPGVLE
MLLKFPCGLKSAALTIEFDKGFLHIDEYPPDAHQGLDIPSAVITFPDFFTSTQFAENNSS
KSPILSKWQGQSPILSYTEVLLVPFTTPDFSMPYNVITITCTVLALYFGSLLNVLRRRVG
EEERFMKDKAKKKFQVSQLVSKLLAKLRGRHWEPSESQAPSSSSNSKSKLLFKVILVAGL
AAAWQYYFG
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcatttctgcgactgatttctttgctgtgtttgccaatcttatttgctgtccca
gccattggatcggtatctgaggggacagaagaagatttctctgaggatttattacttaaa
cccttgcctgatcgcaaggtgttggcgcattttcacttccaaagcagagctccttcgtcc
cgctccaactcctatggccgccaccaccacctattccccaaggccatttctcagctggtt
cataaatatcgaattaaggaaatggaactgtctttcacacaaggtcgttggcgctatgat
cgatggggtggattcgattcgatatcaagcagcaatgcaaagccttcgggagttgagttg
tgggctgtttttgatgttcccccaaatgaggttgatgcatcttggaaaaatttgacccat
tcactttcaggtcttttttgtgcttcaatcaacttcttggagtcctcaacttcttattct
gctcctaaatggggctttcgtcctgcttctgagaatatgaggtatggtacattgcctcgt
gaggctgtttgcacagagaatctaacaccgtggttgaagcttcttccttgtcgtgacaaa
tcagggctttcagtattgatggatcgaccatctatctacaaaggattttatcattctcag
agattgcatttgctgtcaactgaatttgattcaaatgctgtggattcggccattgtactt
gaccagacactcacagttgttcttcagccttatagtcacagaggggctttgggctattca
aatgcagcacaattacaaccaagctggtctctcagctcaatttttgggagaaaagtccca
ggaagatgtgttcttgctaggtctagtaatgtttacattcagcttgacaaaggtctcatg
gcagaactgcaaggcatgcttggggaacaagagatgttagcagttacaagatctagttct
gaaggttctataaggaaccttgcttttgagttgtcagctaatcccgatagagtacatatg
gagatgagtagcagggatgacaagcatttatctgttctttacatgttttcagtagcggag
aagtatgatgaatctgaaccacttgacttgagattcacatggaaaattcctgtagtttgg
tctattccacaagcaccattacatgtgaccaggtttgtactgggtagtgggaatgaaagg
ggtgctattgccttacagctaaaatctacaaaaccaagtgatcagttgatacctaatact
gtgatcacagacagctgtagcttgctggttaaagtttttcaagttgtaccttggtatatc
aaggtgtattatcataccctacaagtatttattgacgaccaaccccattcaattacaaat
gttgttgagaagatgcaagtttcgccttctgaagataaggtttcaccaggagtgctggag
atgctcctgaaatttccttgtggcttgaaatcagctgctctaaccatagaatttgacaag
gggtttctgcacattgatgaatatccaccagatgctcatcagggattagatattccatca
gctgtaataacttttccagattttttcacaagtacgcagttcgcagaaaataactcttca
aaatcaccaatcttgtcaaaatggcaggggcagagtcccattctgtcttacacagaagta
ctgcttgtgccttttaccactcctgattttagcatgccctataatgtgatcacaatcacg
tgcacggtgctcgcattgtattttggatctttgctcaatgtcctccgaaggcgtgtcggt
gaggaggaaagatttatgaaggacaaagcaaagaaaaagttccaggtttcacagttagta
tcaaagttgttggccaaacttagaggaagacattgggaaccctccgagtcacaagcaccc
tcttcatcctccaactcgaagtcaaagctgctgtttaaagtcattttggtagctgggctt
gctgctgcttggcaatattattttggataa

DBGET integrated database retrieval system