KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111808204Help
Entry
111808204         CDS       T05351                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: biotin--protein ligase 1, chloroplastic-like
  KO
K01942  biotin---protein ligase [EC:6.3.4.9 6.3.4.10 6.3.4.11 6.3.4.15]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Pathway
cpep00780  Biotin metabolism
cpep01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    111808204
Enzymes [BR:cpep01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.9  biotin---[methylmalonyl-CoA-carboxytransferase] ligase
     111808204
    6.3.4.10  biotin---[propionyl-CoA-carboxylase (ATP-hydrolysing)] ligase
     111808204
    6.3.4.11  biotin---[methylcrotonoyl-CoA-carboxylase] ligase
     111808204
    6.3.4.15  biotin---[biotin carboxyl-carrier protein] ligase
     111808204
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BPL_LplA_LipB BPL_C
Motif
Other DBs
NCBI-GeneID: 111808204
NCBI-ProteinID: XP_023549815
Position
LG13
AA seq 321 aa AA seqDB search
MDISPTCALILSGKTAADNETAKLLKRNDTSKLPDDTEISVFLHSERDEFLEENGFRIDS
YLNALSTNTFGRFXSTQDIISHNFSDVPLGTVCVADVQFKGRGRSKNLWESPPGCLMFSF
TIQMEDGRIIPLLQYVISLAITEAIKDLCDKEGLPSIDLKIKWPNDLYVNGLKVGGILCT
STYRSKKFNVTAGIGLNVDNNKPSTCLNEALTNLSSTPYRFRKEDILAFFFNKFERLYDI
FINQGFRALEELYYQTWLHSGQRVIVQEKKDDQEVENVVTIQGLTSSGYLLAIGDDSQMC
ELHPDGNRRCCVVMVKRMQLI
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggacatcagtccaacctgtgcgttgatcttgagtggaaaaacggcggctgacaatgaa
actgccaaattactcaagaggaatgacacttcgaaactccctgacgatactgaaatttcg
gttttcttgcattcagaaagggatgaattcctggaggaaaatgggtttcgaattgattcg
tatttgaatgctctttctaccaatacttttggtagattcncttctactcaggatatcatt
tctcacaacttcagcgacgttcccctgggtacggtctgtgtggctgatgttcagttcaag
ggaagaggtcgatcgaagaatttgtgggaatctccccctggttgccttatgttttccttt
actattcaaatggaagatgggcgtattattcctctattacaatatgtaatatctcttgct
attactgaggccattaaagatctttgcgacaaagagggtttaccctctattgatttgaaa
ataaagtggccaaatgatctttacgtgaatggccttaaagttggaggcattttgtgcact
tcaacatatagatcgaagaagtttaatgttactgctggtataggtttgaatgtagacaat
aacaaaccatcaacgtgcttgaatgaagctcttacaaatttatccagtacaccttacagg
ttcagaaaagaggatatcttagcattcttctttaacaagtttgaaagattgtacgatatt
ttcataaatcaagggtttcgggctctcgaggaactctactatcagacatggttgcacagt
gggcaaagagttattgtacaggaaaagaaagatgatcaagaagtggaaaatgttgtcact
attcaggggttgacatcttcaggatatttgctagctattggagatgacagccaaatgtgc
gagcttcatccagatgggaatagaaggtgttgtgttgtgatggtgaaacggatgcagctt
atttga

DBGET integrated database retrieval system