KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111809006Help
Entry
111809006         CDS       T05351                                 

Definition
(RefSeq) serine decarboxylase-like
  KO
K01590  histidine decarboxylase [EC:4.1.1.22]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Pathway
cpep00340  Histidine metabolism
cpep01100  Metabolic pathways
cpep01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    111809006
Enzymes [BR:cpep01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.22  histidine decarboxylase
     111809006
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 111809006
NCBI-ProteinID: XP_023551067
Position
LG13
AA seq 486 aa AA seqDB search
MAACTMTMVEKNAGIEAVIGKFDVNVVFSDPLLPLPEINTVVDLKGQQHAESNQKGKREI
GLGRNAVATCFPITEPDDNDESTGDKEAYMASVLARYRKNLLEKTKYNLGYAYNFDFDYG
ALAPLQHFFINNLGDPFVENNYAVHSRQFEIGVLDWFARLWEIEKNEYWGYVTHCGTEGN
FHGILAGRENFPDGILYASGESHYSVFKAARLYRMNCVKVGCLVSGEIDCADLRVKLLAN
TDKPAILNVNIGTTVKGAVDDLDLVIQTLNECGFSKDRFYIHCDGALFGFMMPFIKRAPK
VSFKKPIGSISVSGHKFLGCPMPCGVHLTRLEHINAFSNNVGYLASRDATIMGSRNGHAS
IFLWYALNRKGYKGFQKEVQKCLGNAHYLKDRLREVGISAMLNELSNTVVFERPQAEEFI
KRWQLICEGNIAHVVTMPNVSQEKLDDFIAELVEKRSIWYADQKVQPPCFAAALGSQNCA
CKLHRI
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggctgcctgtacgatgacgatggttgagaaaaacgctgggattgaggctgtgatcgga
aagtttgatgtcaatgttgtgttttccgatcctctgctgcctttgccggagatcaacact
gtcgtggatctcaagggacaacaacacgcagaatcgaatcagaaagggaagagggagatt
gggctcggcagaaatgccgtcgctacttgcttccccatcaccgagcctgacgacaatgac
gagtctactggtgacaaggaagcgtatatggctagcgtattggcacgctatagaaagaat
ctcctcgagaagactaaatataatttaggttacgcgtataattttgacttcgattatggt
gctctggcgccgttgcagcatttcttcattaacaatcttggggatccgttcgttgaaaac
aattacgctgtgcactcgagacagtttgagattggagtgttggattggtttgctcggctt
tgggagattgagaagaatgagtattggggatatgttacacattgtggaacggaaggaaat
tttcatgggattctcgccgggagagaaaattttcctgatgggattctgtatgcttctggg
gaatctcattattccgttttcaaagccgctagattgtatagaatgaactgtgtgaaggtc
ggctgtctggtatctggtgagatcgattgtgctgaccttagagtcaagttgcttgccaac
acagataaaccagctatactcaatgttaatattggaaccacggtgaaaggagctgtcgat
gatcttgatcttgtgatacaaacactcaacgagtgtgggttctctaaagatcggttttac
atccattgtgatggggcgttgtttggatttatgatgccttttatcaaacgtgcaccaaag
gtctcgtttaagaagcccatcggaagcatcagtgtttccggccacaagttcctcggatgt
ccaatgccttgcggcgttcacctcacaaggttggagcacataaatgccttctccaataat
gtcgggtatctagcctcaagagatgccacaatcatgggaagccggaacggccatgcttct
atcttcctctggtacgccctcaacagaaaaggctataaagggtttcaaaaggaagtccag
aagtgcctcggaaatgcacactacctgaaagaccgacttcgtgaagtgggaattagtgca
atgctgaatgaactgagcaatacagtcgtgtttgaacgacctcaagccgaagagttcatt
aagaggtggcagctaatatgcgaaggaaacattgcccatgttgtgacaatgccgaatgtt
agccaagagaagctggatgatttcatagctgaattggtcgaaaaacgctcaatttggtat
gctgatcagaaagttcaacctccttgtttcgcagcagcgttgggaagtcagaactgtgct
tgtaagttgcacaggatttga

DBGET integrated database retrieval system