KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111809705Help
Entry
111809705         CDS       T05351                                 

Definition
(RefSeq) inositol-tetrakisphosphate 1-kinase 1-like
  KO
K00913  inositol-1,3,4-trisphosphate 5/6-kinase / inositol-tetrakisphosphate 1-kinase [EC:2.7.1.159 2.7.1.134]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Pathway
cpep00562  Inositol phosphate metabolism
cpep01100  Metabolic pathways
cpep04070  Phosphatidylinositol signaling system
Module
cpep_M00132  Inositol phosphate metabolism, Ins(1,3,4)P3 => phytate
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    111809705
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    111809705
Enzymes [BR:cpep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.134  inositol-tetrakisphosphate 1-kinase
     111809705
    2.7.1.159  inositol-1,3,4-trisphosphate 5/6-kinase
     111809705
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ins134_P3_kin Ins134_P3_kin_N
Motif
Other DBs
NCBI-GeneID: 111809705
NCBI-ProteinID: XP_023551860
Position
LG14
AA seq 367 aa AA seqDB search
MAERRFCIGYALAPKKRQSFIQDSLVNLSASRGVDLVRIDTERPLLDQGPFDCILHKFYG
VDWRKQLVEFRLKNPDAFILDSPDSIERLHNRISMLQVVSELKIDNPDETFGIPKQIVIY
DKETLFDRQAWEGLKFPVIAKPLVADGSAKSHKMALVFNHDCLNKLKPPIVLQEFVNHGG
IIFKVYVVGQYVKCVKRKSLPDEPEVKLGNVEGLLSFSQVSNMTPREKIDDKYYKMMQLD
DTEMPPLSFLTDIAGGLRRSMNLNLFNFDVIRDSNIGNRYLIIDINYFPGYAKMPGYEEI
LTDFFCDLAQKKEAMNSPNNKDIEDKIGSDQHGPMQSVDQEITKISIDEDVGGQSVDSGK
KESPVQD
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggcggaacgcaggttttgtataggttatgctttggctcccaagaaacgacagagcttc
atccaagactcgttagtgaatctctcggcgtctagaggagttgatcttgttcgaattgac
actgaacggccacttcttgatcaaggtccattcgattgcattctccacaagttttatggc
gtggattggaggaagcaactggtggagtttagacttaagaatcctgatgccttcattttg
gactcgccggattcgattgagagacttcataaccggatttcgatgcttcaggttgtctcc
gagttgaagattgataatccggatgaaacgtttgggatccctaagcagattgtgatttac
gacaaggagactttgtttgatcggcaggcttgggagggtttgaagttccctgtcattgcc
aagccgttggttgctgatggaagcgctaaatctcacaaaatggcgctcgtattcaaccat
gattgtttgaacaagctcaagcctccgattgtcttgcaggagttcgtgaatcacgggggc
attatctttaaggtttacgttgttggacagtatgtgaaatgtgtgaagcgaaaatctctc
cctgacgagccagaagtgaagttggggaatgtagagggattgttatcattttcgcaggtc
tcgaatatgacacctcgtgagaaaattgacgataagtactacaagatgatgcagcttgat
gatacagagatgccaccgttgagtttcctcaccgacatcgccggagggttgcggcgctcc
atgaacttgaatctttttaacttcgacgtgattcgagactcgaacattgggaatcggtac
cttataattgacattaactatttccctgggtatgccaaaatgccgggttatgaagagatc
ttgacggattttttctgtgatttagcgcagaagaaagaggcaatgaacagtcctaacaac
aaggatattgaggacaagattggttccgatcagcatggcccgatgcagagtgttgatcaa
gaaataacaaagatttccattgatgaggatgttggaggtcaatcagttgacagtggaaag
aaagaatcccctgttcaagattga

DBGET integrated database retrieval system