KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111810304Help
Entry
111810304         CDS       T05351                                 

Definition
(RefSeq) phosphoenolpyruvate carboxykinase (ATP)-like
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Pathway
cpep00010  Glycolysis / Gluconeogenesis
cpep00020  Citrate cycle (TCA cycle)
cpep00620  Pyruvate metabolism
cpep00710  Carbon fixation in photosynthetic organisms
cpep01100  Metabolic pathways
cpep01110  Biosynthesis of secondary metabolites
cpep01200  Carbon metabolism
Module
cpep_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
cpep_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111810304
   00020 Citrate cycle (TCA cycle)
    111810304
   00620 Pyruvate metabolism
    111810304
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    111810304
Enzymes [BR:cpep01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     111810304
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPCK_ATP AAA_33 AAA_24
Motif
Other DBs
NCBI-GeneID: 111810304
NCBI-ProteinID: XP_023552764
Position
LG14
AA seq 658 aa AA seqDB search
MAANGNAEFSFAKHGSARNGLSKIQTQKNGICHDDSAPPVKAQTIDELHSLQRKKSAPTT
PIKGTEGAFSPLSEEERQKQQLQSISASLASLTRETGPKLVKGDPARKSETAKGHAVHHH
YHAPTISVSDSSLKFTHVLYNLSPAELYEQAIKYEKGSFITSTGALATLSGAKTGRSPRD
KRVVRDETTEDDLWWGKGSPNIEMDEHTFMVNRERAVDYLNSLDKVFVNDQFLNWDPENR
IKVRIVSARAYHSLFMHNMCIRPSPEELENFGTPDFTIYNAGQFPCNRYTHYMTSSTSID
INLSRREMVILGTQYAGEMKKGLFSVMHYLMPKRQILSLHSGCNMGKDGDVALFFGLSGT
GKTTLSTDHNRYLIGDDEHCWSDNGVSNIEGGCYAKCIDLVREKEPDIWNAIIFGTVLEN
VVFDEHTREVDYTDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVS
KLSLAQTMYHFISGYTALVAGTEDGIKEPQATFSACFGAAFIMLHPTKYAAMLAEKMQKH
GATGWLVNTGWSGGRYGQGNRIKLPYTRKIIDAIHSGQLLNATYKRTEVFGLEIPIEIDG
VPSEILDPINTWSDKKAYKDTLLQLGGLFKKNFETFTNYKIGKDNKLTDEILAAGPNF
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atggcggcaaacgggaacgcagagttcagtttcgcgaagcatggatcggcgagaaacggt
ctgtcgaaaattcagacgcagaagaacgggatctgtcacgacgatagtgcgccgcctgtt
aaggcgcagaccattgatgaactgcactcgctgcagaggaagaaatcggccccaactact
cccattaaaggcactgaaggagccttctctccgctctctgaagaggagaggcagaagcag
caacttcaatccatcagcgcttcattggcatcattgacaagagaaaccggaccaaaattg
gtgaaaggggatccggcgaggaaatcagaaaccgccaaaggccatgcggtgcaccaccac
taccatgcgccgacaataagcgttagcgacagctccctgaagttcacccatgttctttac
aatctctccccagcagaactttacgagcaggcgataaagtatgagaaagggtcatttatc
acgtcgaccggtgcgttggcgactctttctggtgcgaaaaccggccgatctccgagagat
aaaagagttgtcagagatgaaaccaccgaggatgatctttggtggggaaagggttccccg
aacattgaaatggacgagcatactttcatggttaacagagaaagggctgttgattacctc
aactcattggacaaggtgtttgtgaatgaccagttcttgaattgggacccggagaacaga
atcaaagttcgtatcgtctctgcaagagcctaccattcactgtttatgcacaacatgtgt
atccgaccctctcctgaagagctggagaatttcggtactccggacttcactatttacaat
gctgggcaattcccgtgtaatcgttacactcactacatgacatcctctactagcatagat
attaacctttctaggagggaaatggtcatcctcggcactcaatacgccggggaaatgaag
aaaggtttattcagtgttatgcattatctgatgcctaagcgtcaaatcctctccttacat
tctggctgcaacatgggaaaagatggagatgttgccctcttctttggactctcaggtact
ggaaagacgacattgtcgaccgatcataataggtatctgattggggatgatgaacattgt
tggagtgataatggtgtgtcgaatattgaaggaggttgctatgccaaatgcattgatctc
gtgagagaaaaggagccagacatttggaatgccatcatatttggaactgtgctcgaaaac
gtggtgtttgatgaacatacccgagaagttgattataccgacaaatcagtcacagagaac
acaagggcagcttaccccattgaatacattccaaatgcaaaaataccatgtgttggcccg
cacccaaagaatgtgattttattggcctgtgatgcatttggggtgcttccaccggtgagc
aagctgagcctagcacagaccatgtatcatttcatcagtggttacactgcactggtggca
ggcacagaagacggaatcaaagagccacaggcaacgttctcggcttgtttcggggctgct
tttataatgctacatccaactaaatacgcagccatgctagctgagaagatgcagaagcat
ggcgccacgggatggctcgtaaacactggttggtctggtggaaggtatggccaagggaac
cgcattaagctaccatacacaaggaagatcatcgacgcaattcactctggccagctttta
aacgcaacatacaagagaaccgaagtattcgggctcgaaattcccattgagatcgacgga
gtgccttcagaaatcttggatcccattaacacttggtcggacaagaaggcgtacaaggat
acgttgcttcagctgggagggttgttcaagaagaactttgagacatttaccaactacaag
attgggaaggataacaagctgacagatgagatactcgcagctgggccaaatttctaa

DBGET integrated database retrieval system