KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111811144Help
Entry
111811144         CDS       T05351                                 

Definition
(RefSeq) fructose-1,6-bisphosphatase, cytosolic
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Pathway
cpep00010  Glycolysis / Gluconeogenesis
cpep00030  Pentose phosphate pathway
cpep00051  Fructose and mannose metabolism
cpep00710  Carbon fixation in photosynthetic organisms
cpep01100  Metabolic pathways
cpep01110  Biosynthesis of secondary metabolites
cpep01200  Carbon metabolism
Module
cpep_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
cpep_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111811144
   00030 Pentose phosphate pathway
    111811144
   00051 Fructose and mannose metabolism
    111811144
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    111811144
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cpep04147]
    111811144
Enzymes [BR:cpep01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     111811144
Exosome [BR:cpep04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   111811144
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FBPase Inositol_P
Motif
Other DBs
NCBI-GeneID: 111811144
NCBI-ProteinID: XP_023553653
Position
LG15
AA seq 403 aa AA seqDB search
MQSTSILPFNPPLSFPPNLPRFAPIIRHFPSPSKLRLPISMASSPSGLAVGSRTETISSR
AAFDGLYTLTDFVGKDGIGLGDDLVLLLTHIQYACKRIAALVASPFSSDLQNPAGLVVGG
GVAVGAERDAPKPLDIVSNEIILSSLKKSGKVAVMASEEDDEPVWIRDDGPFVVVTDPLD
GSRNIDASIPTGTIFGVYKRLVELDNLPREEKAVLNSLQSGTKLLAAGYVLYSSATILCA
SFGSGTHAFTLDHSTGDFILTHPHIKIPPRGQIYSVNDARYFDWPEGLRRYIDTIRQGKG
KSPKKYSARYICSLVADLHRTLLYGGVAMNPRDHLRLVYEANPLSLLVEQAGGRGSDGKN
RILSMQPGKLHQRLPLFMGSLEDMEELESYGDVQQKVNPGYEV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcaatccacaagcattctccctttcaatccccccctttcttttcccccaaatcttcct
cgtttcgccccaataatccgccatttcccctctccttccaagcttcgcctgcccatatct
atggcttcttcgccttctgggctcgccgtcgggtcgcgaacagagactatttcgagcagg
gccgcctttgatggcctctatactttgaccgactttgtgggaaaggacgggattggtttg
ggagatgatttggtgctgctgttgactcatattcagtatgcttgcaagagaattgccgct
ctcgtcgcttctcccttcagttccgatcttcaaaatcctgcgggtttggttgtcggcggt
ggagtggctgttggagcggagagggatgcacccaagccgctcgacattgtgtctaatgaa
atcatcttatcatcccttaaaaagtctggaaaagttgctgtgatggcttcagaagaagat
gatgagccagtttggattagagatgatggtccatttgtggtggtaacagatccgctcgat
ggttctcgaaacatcgatgcatcgatacctactggcacaattttcggggtttataaacgt
cttgttgaacttgataacttaccgagagaagagaaggccgtgcttaattctctacagagt
ggaactaaacttttggcagctggatatgttctctactcatcagctacaatactctgtgcc
agctttggttctgggacacatgcatttacactggaccattctactggggacttcattctt
actcatcctcatatcaaaatccctcctcgagggcaaatatattccgtaaacgatgcgaga
tattttgattggccggaaggattgcggcgatatatcgacacaatcagacagggaaaaggc
aaaagtccaaagaagtactccgcccgttacatatgttctctggttgccgatctccatcga
actttattgtacggcggagtggcaatgaatccaagagaccatcttcgtctagtatatgag
gcgaaccctcttagcctccttgtcgagcaagccggaggccgaggctcagatggtaaaaac
cgaattctttcaatgcagccgggtaagctgcatcaaaggctgcctttgttcatggggagt
ttggaggacatggaggagcttgaaagctatggagatgtacagcagaaagtgaatcctggt
tatgaagtttga

DBGET integrated database retrieval system