KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111811379Help
Entry
111811379         CDS       T05351                                 

Definition
(RefSeq) 3-ketoacyl-CoA thiolase 2, peroxisomal-like
  KO
K07513  acetyl-CoA acyltransferase 1 [EC:2.3.1.16]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Pathway
cpep00071  Fatty acid degradation
cpep00280  Valine, leucine and isoleucine degradation
cpep00592  alpha-Linolenic acid metabolism
cpep01040  Biosynthesis of unsaturated fatty acids
cpep01100  Metabolic pathways
cpep01110  Biosynthesis of secondary metabolites
cpep01212  Fatty acid metabolism
cpep04146  Peroxisome
Module
cpep_M00087  beta-Oxidation
cpep_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    111811379
   00592 alpha-Linolenic acid metabolism
    111811379
   01040 Biosynthesis of unsaturated fatty acids
    111811379
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    111811379
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    111811379
Enzymes [BR:cpep01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     111811379
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C
Motif
Other DBs
NCBI-GeneID: 111811379
NCBI-ProteinID: XP_023553959
Position
LG15
AA seq 453 aa AA seqDB search
MEKALNRQRVLLQHLQPSSSSSGSASLSASVCAAGESASHSYHRTGAFGDDIVIVAACRT
AICRAKKGGFKDTPAEDLLASVLKAVIEKTELNPSEVGDIVVGTVLAPGSIRASECRMAA
FYAGFPDTVSIRTVNRQCSSSLQAVADVAAAIKVGYYDIGIGAGLECMSINDIEFPVSDN
PKANVFRQARDCMLPMGITSENVAQQYGVSREEQDQAAVESHRRAAAASASGKFKDEIIP
VSTKIVDPKSGVAKPVVVSVDDGIRPSTNMEILGKLKPAFKKDGCTTAGNSSQVSDGAAA
VLLMKRSLAIQKGLPILGVFRSFSVVGVDPAVMGIGPAVAIPAAVKSAGLTLQDIDLFEI
NEAFASQYVYCCKELKLDTQKVNVNGGAIALGHPLGATGARCVATLLSEMKRRGRDSRFG
VISMCIGSGMGAAAVLERGDSVDELGNARPTSH
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggagaaggcacttaacaggcagcgggttcttcttcaacatttgcagcccagctcttct
tcttctggatctgcatcgctttctgcttcggtttgtgctgctggagaaagcgcttcacat
tcataccataggactggtgcgtttggggatgatattgtcattgtagcagcatgtcgtaca
gcgatttgcagagcaaagaaagggggtttcaaggatactcctgcagaggatcttcttgca
tctgttctaaaggctgtgatcgagaaaacagaactgaatccgagtgaagttggtgatata
gtagttggcactgttttggctcctggctctataagagcttctgaatgcaggatggctgct
ttctatgctggcttccctgacacggtaagcataagaacggtcaaccgacagtgctcgtcc
agccttcaagctgttgctgatgttgctgctgccattaaagttggatattatgatattggc
attggtgctgggttggagtgcatgtctattaatgacattgaatttcctgttagcgataac
cccaaagcaaatgtctttagacaagctcgagattgtatgcttccaatgggcatcacttct
gaaaatgttgcccaacaatacggtgtgagtagggaagagcaagaccaggctgctgttgaa
tcgcataggcgtgctgctgcagcaagtgcatctggtaaattcaaagacgagatcatccct
gtctccactaagatcgtcgacccaaaatctggtgttgcaaagcccgtggttgtatctgtg
gatgatggcatacggccgagcacaaacatggaaattttgggaaagttgaagccagcattc
aagaaagatggctgcacaacagcagggaactctagtcaagttagtgacggtgctgctgca
gtcctcctcatgaaaagaagcttagctatccagaagggacttcctattcttggtgtcttt
aggagtttttcagtagttggtgttgatccagcagtgatgggaattggaccagctgttgca
attcctgcagctgttaaatctgctggtcttactctccaagatattgacctttttgaaatt
aatgaggcatttgcatctcagtatgtgtattgctgtaaggaactaaagcttgatactcaa
aaggtgaatgtcaatggcggtgcaattgctctgggccaccctttgggcgcaactggtgct
cgttgtgtagcgacactcttgagtgaaatgaagcgtcgtggaagggacagtcgatttggg
gtcatctccatgtgcataggctcgggaatgggggctgcagctgtactagaaagaggcgac
tctgttgatgagcttggcaacgcaaggccaacctcccactaa

DBGET integrated database retrieval system