KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111811391Help
Entry
111811391         CDS       T05351                                 

Definition
(RefSeq) phosphatidylserine decarboxylase proenzyme 2-like
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Pathway
cpep00564  Glycerophospholipid metabolism
cpep01100  Metabolic pathways
cpep01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    111811391
Enzymes [BR:cpep01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     111811391
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PS_Dcarbxylase EF-hand_1 EF-hand_5 EF-hand_8 EF-hand_6 EF-hand_7 C2 NT-C2 zf-ribbon_3
Motif
Other DBs
NCBI-GeneID: 111811391
NCBI-ProteinID: XP_023553974
Position
LG15
AA seq 653 aa AA seqDB search
MGNGSSKLESSSSSDPDAEDSRGSRFKKRMHLRRFLRRRRGGDANGKGIRSHTKLGSVED
FAGIAVLTLISAQMNFKDKWLACVSFGEQTFRTGISDHTKDPAWNSEKKLLLEKDGPHIA
RISVFETNRISRNNLVGYCEIDLLEFLSQDSSSEELKLLDPSPPNAVVGKIYVSCSVEDP
IETEKRFAKRILSIVDYNEDGELSFPEFSDLIDAFGNQVAASKKEELFKAADKNGDGVVT
LDELAALLAAQQEKEPLMNRCPVCGEVLEVSDKLNNMIHLTLCFDEGTGNQVMTGGFLTD
KQAAYGWMFKLSEWAHFSSYDVGLNSGSSASHIVVYDRQKKRLVEEIIDGKIVLSMRAIY
QSKVGLALMDKGVKELLHSISEKQGKRMDSVESAKDIPHFIESFKDQINMNEVKHPLEYF
KTFNEFFIRELKPDVRPIAHVECDDVAVCAADCRLMAFKSIDDSLRLWIKGRKFSVQGLL
GQEISAGAFMDGTLVIFRLAPQDYHRFHFPVSGFIEQIVDIPGCLYTVNPIAVNSKYCNV
FTENKRSVAIISSSDFGKVAFVAIGATMVGSITFTKGKGDYVKKGEEFGYFSFGGSTVIC
VFEKDSIQIDEDLLANSSRSLETLVRVGTKLGVSTRRVSQADLPDVRRCALDD
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atggggaatggcagttccaagcttgagtcttcctcctcttcagatcccgatgctgaagac
tcgcgtggttctcgattcaagaagcgtatgcatcttcgtcgatttcttcgaaggcgtcgt
ggaggagacgccaatggcaaaggaattcgttctcataccaaacttggctctgtggaggat
ttcgctggaatcgctgttcttactcttattagtgcgcaaatgaatttcaaggataagtgg
ctcgcttgtgtttctttcggagagcagacttttcggacgggaatctctgatcacactaaa
gacccagcttggaactctgaaaagaagcttctcttggagaaggatggacctcatattgcg
agaatctctgtttttgagactaatagaatatcccgaaacaaccttgttggatattgtgag
atcgatctacttgaatttctatcacaggattcaagctctgaggaactcaaattgttggat
ccatcaccgcctaatgcagtggttggaaaaatttatgtgtcatgttctgttgaggacccg
atcgaaacagagaaacgctttgcaaaacgcatcttatctattgtggattataatgaggat
ggagagctctcattccctgaattttctgacttaattgatgcttttggcaatcaagtggca
gcttctaagaaggaggagctttttaaggcagctgacaagaatggggatggtgttgtcacg
cttgatgagttggctgctcttcttgctgctcaacaagagaaggaaccattgatgaatcgc
tgccctgtttgtggtgaagttcttgaagtttctgataaactgaacaatatgattcacttg
actctatgttttgatgaaggaactggaaaccaagttatgaccggagggttcttgaccgat
aaacaggctgcatatgggtggatgtttaagttaagcgaatgggcccatttttcatcgtat
gatgttggtctaaactctggttcaagtgcatctcatattgtagtttatgatcggcagaaa
aaaaggctagtggaagagataattgatggaaagattgttttgtcaatgagggccatctat
cagtcaaaagtcggtcttgctcttatggataaaggggtgaaagaactcttacatagcatt
tctgaaaagcaaggaaagcggatggattcagttgaatctgcaaaagatattccacatttc
attgaatctttcaaggatcaaatcaatatgaatgaagtgaagcatcctttagaatatttc
aagacatttaatgaattctttataagagagttgaagcccgatgtgagaccaattgcacat
gtggaatgtgatgatgttgcagtatgtgctgctgattgccgattaatggcatttaaatca
atcgatgacagcctaaggttgtggattaaggggcggaagttttcagttcaaggtcttcta
gggcaagagataagcgcgggtgcttttatggatgggacgttggtgatatttcgtctggca
ccacaagattatcatcgcttccattttccagtctctggattcattgaacaaattgtggac
atacctggatgcctgtatactgttaatccaattgctgtcaatagcaagtattgcaatgtc
ttcacggaaaacaagcgatcagtagctataatttcatcttctgattttggcaaggttgct
tttgttgcaattggagctaccatggttggcagcataaccttcacaaaagggaagggagat
tatgtaaaaaaaggagaagagtttgggtatttctctttcggtggaagtactgtaatttgt
gtctttgaaaaggactcgatccagatagatgaggacctgttagcaaatagttccagatca
cttgaaactttggttcgtgttgggactaagcttggtgtttctactagaagagtttctcaa
gctgatttgccagatgtaagacgctgtgccttggatgactga

DBGET integrated database retrieval system