KEGG   Chlamydia pecorum W73: CPE2_0772Help
Entry
CPE2_0772         CDS       T02855                                 

Definition
(GenBank) insulinase family protein
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
cper  Chlamydia pecorum W73
Brite
KEGG Orthology (KO) [BR:cper00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cper01002]
    CPE2_0772
Enzymes [BR:cper01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     CPE2_0772
Peptidases and inhibitors [BR:cper01002]
 Metallo peptidases
  Family M16: pitrilysin family
   CPE2_0772
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M16_M Peptidase_M16 Peptidase_M16_C
Motif
Other DBs
NCBI-ProteinID: AGW39171
Position
880727..883555
Genome map
AA seq 942 aa AA seqDB search
MKWLKVRMSLLCLSLLVTSCNKHPQVIKDKCPLKVLTSAIAHRQVAKVICRNGLPLLIIS
APHLPTSGAALLVKTGNNADPEEFPGMAHFTEHSVFLGNKKYPSVNGFSNFLSSHNGTYN
AFTSSATTTYIFSVERSAFKQAIDQFVHLFIHPLFRQEDLDREKHAVHQEFSSHPLSDGR
RVHRIQQLISPEGHPMHRFGCGNASTLAPVTQEAMTSWFKKHYSPENMCAIVYTPEPISK
AIKSLSKLFSQIPVSKQYQKQEDFLPSEDTSSLCHLYINKAVQSTSCLEVYWHLYHPLSK
ISQGCYAALAQMLKHEGEYSLASKLKEEQLITKIDVDIGKSSFNTKDFFICYELTQKGEQ
NYAQVLQYTFQYLQKIQKQGIPSYCVQELSTMNTLEYSYASKSELFDLLTKQVKELADED
LATYPYHTLVYPQHTPEEESSLLQVLADPKQARYVISAKDPSTWEGLQEHYDDIFDMTYY
VKSLKEEVAQCKDLALESTMEFPKPNAFIPKDIETPPLTTSDKTRFPFTPTLKHKDEKLT
VYYCEDHYFASPKISSQLRIRTPQISRKDPQSLVNAELYCLALNEKLLELYYPATLAGLS
FASYLGGEGIDIKISGYTATAPKLLNSILGSLPAFSISESKFVIYKQKLLESYEKSLRAC
PLRAGLDELFSQTIENVYSHREKLSLLQKLTFEQFQVFSSQLLNQVHVEAMLLGNLSDKQ
QEDFITKIQEFTSHISAYSAQPFYYQLQKNTPASIEYTYPLTTNGMLLWLQNPQTPSIQS
LVATEILFDWLHHITFEELRTQQQLGYMVGARYRELASQPFGFFYIRSNAYSPEALISKT
QEFISNVAKCPEKFEMSSKYFNSMKEAYISRLREPEYSLETANSILFSLAFEFPSEQLSI
PNKKIAAAKALSYEEFLSYSQIFLAEELGKRIPVYIQGAPAT
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggttaaaagttcgcatgtccctgctatgtctctctttgctagtaacgtcatgc
aacaagcacccacaagttattaaagacaaatgtcctctaaaagtattaacttcagcaatc
gcacaccgacaagttgctaaagttatctgtcgtaatggtttaccactactaattatttct
gcgccccatcttcctacctctggagcggccttactagtaaaaacaggaaataatgctgat
cctgaagaattccccgggatggcgcactttacagaacatagcgtcttcttggggaataaa
aagtaccctagtgtgaatggcttttcaaatttcctaagtagccataacggcacatacaat
gccttcacttcatcagcaacaacaacctacatcttttctgtagagcgctctgcatttaaa
caggctatagatcaatttgtacacctgtttatccatcctctatttcgtcaggaagatctc
gatagagaaaaacatgctgtgcatcaggagttctctagtcatcctctttctgatggcagg
cgcgtacatcgtatccaacaacttatctctccagaggggcatcctatgcaccgctttggc
tgtggcaacgcctctactttagctcctgtaactcaggaggccatgacctcgtggtttaaa
aagcactattccccagaaaatatgtgtgctattgtctacacaccagaacctatttctaaa
gcgatcaagtctctatctaagctcttctctcagattccggtttctaaacaataccaaaag
caagaggacttccttccctctgaagatacatcttctttgtgtcatctctatattaacaaa
gctgtgcaatccacatcatgtttagaagtgtattggcatctataccatcctctgtcaaaa
atttcccaagggtgttatgcggctcttgcacagatgcttaaacatgaaggagaatatagc
ctagcatcgaaattaaaagaggagcaactcattacaaaaatcgacgtggatatagggaaa
agttcttttaacactaaggacttttttatctgctatgaactgacacagaaaggtgagcag
aactatgctcaagtacttcagtataccttccaataccttcaaaagattcaaaaacagggc
atccctagctattgtgtgcaagagctatctactatgaataccttagaatatagctacgca
tcaaaaagcgagctattcgatctccttaccaaacaagttaaggagcttgctgatgaagac
cttgctacctatccctaccataccctagtgtatcctcaacatactcctgaggaagaatcc
tctttgttacaagttcttgcagatccaaaacaagctcgttatgtgatctctgctaaggat
ccctccacttgggaaggcctccaggagcattatgatgacatctttgacatgacttactac
gtaaaatctctcaaagaagaggttgcacagtgcaaggacctagcgttagagtctacgatg
gaattccccaagcccaacgctttcattcccaaggatatagagactcctccattaacaact
tctgataaaacacgtttcccctttactcctactcttaaacataaggatgagaaactcacc
gtatattactgcgaagatcactattttgcttctccgaaaatctcttctcagctacgtatt
cgcacgcctcaaatctcacgtaaggacccacaatctttagtaaatgcggagctttattgc
cttgctttaaatgaaaagctccttgagctatattatcctgcaacgctagcaggcctttcc
tttgcgtcgtacttagggggagagggtattgatatcaaaatttcagggtacactgcgaca
gctccaaagcttttaaattctatccttggctctttacctgcattttctattagcgaatct
aaatttgtgatatacaaacaaaagctcttagagagttatgaaaagtccttacgggcctgt
cctttacgtgcgggcctggatgagctcttttctcaaaccattgagaacgtgtattctcat
agggaaaaactttctcttcttcaaaaactcacattcgagcagttccaggtcttctcttcg
caactgctaaatcaagtacatgttgaagcaatgttgctagggaatctctcagacaagcaa
caggaagattttattacaaaaatccaagagtttacttcccatatctcagcatactctgct
caacctttttactatcaattgcagaaaaacacgcctgcttctattgagtatacctatccc
ctgacgacaaatggtatgctactctggctacaaaacccgcagactccttctattcaaagc
ctggttgctacggagatattatttgattggctacaccacattacttttgaagaactgcgt
acgcaacaacagttaggttatatggttggagcccgttatcgagaacttgcatcacaacct
tttgggttcttttatattcgctcgaatgcgtattctcctgaagcactaatttcgaaaact
caggagtttatcagcaatgtcgctaagtgccctgaaaaatttgaaatgtcttccaagtac
ttcaacagcatgaaagaggcctatattagcaggctccgagaacctgagtactctttagaa
acagcaaattccatactattttccttagcttttgagtttccctcggaacaactctctatc
cctaataaaaagattgctgcggccaaagcattaagctatgaagagttcctgtcctatagt
cagatctttctcgctgaagagcttgggaagaggatccccgtatatattcaaggagctcct
gctacctaa

DBGET integrated database retrieval system