KEGG   Clostridium perfringens ATCC 13124: CPF_1356
Entry
CPF_1356          CDS       T00378                                 

Symbol
pfl
Name
(GenBank) formate acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
cpf  Clostridium perfringens ATCC 13124
Pathway
cpf00620  Pyruvate metabolism
cpf00640  Propanoate metabolism
cpf00650  Butanoate metabolism
cpf01100  Metabolic pathways
cpf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cpf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CPF_1356 (pfl)
   00640 Propanoate metabolism
    CPF_1356 (pfl)
   00650 Butanoate metabolism
    CPF_1356 (pfl)
Enzymes [BR:cpf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     CPF_1356 (pfl)
SSDB
Motif
Pfam: PFL-like Gly_radical DUF3029
Other DBs
NCBI-ProteinID: ABG83251
UniProt: A0A0H2YS31
Position
1529447..1531681
AA seq 744 aa
MFKQWEGFKEGVWQNGIDVRNFIQKNYTAYEGDKSFLEGTTKRTDAVLEKAQKLIIEEIE
KGIIDVATDRVSGIDNYEPGYLDKDNEVIVGFQTDAPLKRIVNPFGGMRMVESSLKEYGY
ELDSSIREHFNAYRKTHNQGVFDAYSAETRAARSAGLLTGLPDAYGRGRIIGDYRRIALY
GIDYLIEEKKKDYANISFESEGSVEEYIQLRENVSEQIRALEAIKSMAARYGFDISKPAA
NAKEAVQFLYFGYLAAVKENNGAAMSLGRTSTFLDIFIERDLKAGTLTELEAQELIDQFI
IKLRLVRHLRTPEYNDLFAGDPTWVTEGIGGMGVNGKPLVTKNSFRYLQTLINLGPAPEP
NMTVLWSDRLPEGFKKFCAEVSIKTDSIQYENDELMRPIYGDDYSIACCVSAMQIGKQMQ
FFGARTNLAKALLYTINGGIDEKSGKVVIKGLEPITDEVLDYDKLRANYDKVLEYVAKLY
VDTMNVIHYMHDKYAYEAGQMALHDTHVGRLMAFGIAGLSVVADSLSAVKFAKVKPIREN
GIAVDFEIEGDFPKYGNDDDRVDDLAVEIVRKFSSELKKHPLYRGAKHTLSILTITSNVV
YGKKTGSTPDGRKAGEAFAPGANPMHGRDNSGALASLNSVAKIPYCEVCEDGVSNTFSIV
PDALGKEEDSRIDNLVAIMDGYFKQGAHHLNVNVFNRETLMDAMEHPEKYPTLTIRVSGY
AVNFNRLTRNQQLEVISRTFHDSL
NT seq 2235 nt   +upstreamnt  +downstreamnt
atgtttaaacaatgggaaggctttaaagaaggagtatggcaaaatggaatagatgttaga
aacttcatacaaaagaactatactgcatatgagggagacaagagtttcttagaaggaaca
acaaaaagaactgatgcagttttagaaaaagctcaaaagttaattatagaagaaatagaa
aaaggcattatagatgttgctacagatagagtatctggaatagacaattatgagcctgga
tatttagataaagataacgaagttatcgttggtttccaaacagatgcaccacttaaaaga
atagttaatcctttcggtggaatgagaatggttgaaagttctttaaaagaatacggctat
gaattagatagcagtataagagaacactttaacgcttatagaaaaactcataaccaaggt
gtattcgatgcatactcagctgaaacaagagctgcaagatctgcgggtcttttaactggt
cttccagatgcttatggtagaggaagaattataggtgactatagaagaattgccctttac
ggtatagattatctaatagaagaaaagaaaaaagattatgctaatatatcatttgaaagc
gaaggctcagtagaagaatatattcaattaagagagaatgtttcagagcaaataagagct
ttagaagcaataaagtcaatggctgcaagatatggctttgatatatctaaaccagctgca
aacgctaaggaagcagttcaattcttatactttggatacttagctgcagttaaagaaaac
aatggagcagcaatgtctctaggaagaacttctactttcttagatattttcatagaaaga
gatcttaaggctggaactttaactgagttagaagctcaagaattaatagatcaatttata
ataaaattaagattagttagacacttaagaactcctgagtataatgatttatttgctgga
gacccaacttgggtaacagaaggtattggaggtatgggtgtaaatggtaaaccattagta
actaaaaactcatttagatatcttcaaactttaataaacttaggacctgctccagaacca
aatatgactgttttatggtcagatagattaccagaaggattcaaaaaattctgtgctgag
gtatcaattaaaactgactcaattcaatatgaaaatgatgagttaatgagacctatatac
ggagatgattactcaatagcttgttgtgtatcagcaatgcaaattggtaagcaaatgcaa
ttcttcggagctagaactaacttagctaaagctttactttacactataaatggtggtatt
gatgaaaaatcaggtaaagttgttattaaaggtttagagccaataacagacgaagtttta
gattatgataaattaagagctaactatgataaagttttggagtacgttgctaagctttat
gtagatacaatgaatgttatccactacatgcatgataaatatgcttatgaagctggacaa
atggctttacatgatactcatgtaggaagattaatggcatttggtatagctggtttatca
gttgtagctgactcattaagcgcagttaaattcgctaaagttaaacctataagagaaaat
ggaatagctgtagactttgaaatcgaaggtgacttccctaaatacggaaatgatgatgat
agagttgacgatttagctgtagaaatagttagaaagttctcaagtgagcttaagaaacat
ccattatatagaggtgctaagcacacattatcaatcttaactattacttcaaacgtagtt
tatggtaagaaaacaggttcaactccagatggaagaaaagctggtgaagcatttgctcca
ggagctaacccaatgcatggaagagataacagtggagctttagctagcttaaactcagtt
gctaaaattccatactgtgaagtttgtgaagatggtgtatcaaacacattctcaatcgtt
ccagatgctttaggaaaagaagaagattctagaatagataacttagttgctattatggat
ggttacttcaaacaaggagctcaccatctaaatgttaatgtatttaacagagaaacttta
atggacgctatggagcatcctgaaaagtatccaacattaacaatcagagtatcaggttat
gctgttaatttcaatagattaactagaaatcaacaattagaggttataagcagaacattc
cacgattctctataa

DBGET integrated database retrieval system