KEGG   Clostridium perfringens ATCC 13124: CPF_0094Help
Entry
CPF_0094          CDS       T00378                                 

Gene name
gldA
Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
cpf  Clostridium perfringens ATCC 13124
Pathway
cpf00561  Glycerolipid metabolism
cpf00640  Propanoate metabolism
cpf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CPF_0094 (gldA)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    CPF_0094 (gldA)
Enzymes [BR:cpf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     CPF_0094 (gldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase DUF4946
Motif
Other DBs
NCBI-ProteinID: ABG83028
UniProt: A0A0H2YQ72
Position
112515..113645
Genome map
AA seq 376 aa AA seqDB search
MRKAFICPTKYVQGENELLNLGYFVETYGKSALLIAHPEDIKRVKDKLDATAKKFNIEFV
EGGFKGECSRQEVKRLQDLAKEMKCDCTVGLGGGKALDTAKCVAEGEKLIVVPTIAATDA
PTSHSAVLYTEDGSFDDYAYFKASPSVVLVDTEVIAKAPTRFLVAGMGDALSTYFEARAT
SSSFTKVNAGLPCGVREEKCRPAIGTNASLALAKLCYETLLEDGKKAKDACDCNCVTKSL
ENIVETNILLSGLGFESGGLAAAHAIHDGLTILEGTHGYFHGEKVAFGTIAQLVLENAPK
EELYEVLDFCLEIGLPVCLEDIGVTEVSDEELFEVAEKACIPEESIYSMPFGIEVSEVVS
AIKLADKIGKDYKNRK
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaggcttttatatgcccaacaaaatatgttcaaggagaaaatgaattacttaat
ttaggttactttgtagagacttacggaaagtcagcacttttaatagctcatccagaagat
ataaagagagttaaagataaattagatgcaacagcaaagaaatttaacattgaatttgta
gaaggcggatttaaaggtgaatgttcacgtcaagaagttaaaagacttcaagatcttgca
aaggaaatgaaatgtgattgtacagtaggtcttggtggaggaaaagctttagacacagct
aaatgtgttgctgaaggtgaaaaacttatagtagtaccaacaatagcagctacagatgct
ccaactagtcactcagcagttttatatacagaagatggatcatttgatgattatgcatac
tttaaagcaagcccaagtgttgttttagtagacacagaggtaatagcaaaagctccaact
cgtttcttagtagcaggtatgggagatgctttatcaacttactttgaagcaagagcaaca
tcaagttcatttactaaagtcaatgcgggattaccatgtggggtaagagaagaaaaatgt
agaccagcaattggaacaaatgcttcattagcacttgctaagctttgctatgaaacatta
ttagaagacggaaagaaagctaaagatgcttgtgattgtaactgtgttactaaatcttta
gaaaatatagtagaaacaaacatattattatcaggtttaggatttgagagtggtggatta
gctgcagctcatgctatacatgatggtttaacaatattagaaggaacacatggatatttc
catggagaaaaggttgcttttggaacaatagctcaattagttcttgaaaatgcaccaaaa
gaagaattatatgaagttttagatttctgtttagaaataggtcttccagtatgtcttgaa
gatataggtgtaacagaagtttcagatgaagaattatttgaagttgcagaaaaagcttgt
ataccagaagagtcaatttactcaatgccatttggaatagaagtttcagaagtagtatca
gcaattaaattagcagataagataggtaaagactacaaaaatagaaaataa

DBGET integrated database retrieval system