KEGG   Clostridium perfringens ATCC 13124: CPF_0904Help
Entry
CPF_0904          CDS       T00378                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
cpf  Clostridium perfringens ATCC 13124
Pathway
cpf00480  Glutathione metabolism
cpf00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cpf00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    CPF_0904
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CPF_0904
Enzymes [BR:cpf01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CPF_0904
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ABG83807
UniProt: A0A0H2YS63
Position
1068180..1068656
Genome map
AA seq 158 aa AA seqDB search
MEIYDISVKDINGENVSLERYRGKVLLIVNTASKCGFTKQFDGLEELYEKYKDEGFEVLG
FPCNQFKEQDPGSNSEIMNFCKLNFGVTFPMFEKIDVNGENESLLYSYLKEQKSGMFGSK
IKWNFTKFLVDREGNVIKRFSPQTTPKSIEKDIEELLD
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggaaatttatgatattagcgtaaaagatattaatggagaaaatgtaagtttagaaaga
tatagaggaaaggttcttttaatagttaatactgctagtaaatgtggttttacaaaacag
tttgatggattagaggagttatatgaaaaatataaggatgaaggttttgaggttttagga
ttcccttgtaatcaatttaaggaacaagatccaggaagtaattcagaaataatgaacttt
tgtaaattaaattttggtgtaacattccctatgtttgaaaaaattgatgttaatggagaa
aatgaatctctattatattcatacttaaaagaacagaaaagtggaatgtttggaagtaaa
attaagtggaattttactaagtttttagtggatagagaaggaaatgtaataaagagattt
tcaccacaaactactccaaaatcaatagaaaaagatattgaggaacttttagattaa

DBGET integrated database retrieval system