KEGG   Clostridium perfringens ATCC 13124: CPF_1389Help
Entry
CPF_1389          CDS       T00378                                 

Definition
(GenBank) phosphofructokinase family protein
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
cpf  Clostridium perfringens ATCC 13124
Pathway
cpf00010  Glycolysis / Gluconeogenesis
cpf00030  Pentose phosphate pathway
cpf00051  Fructose and mannose metabolism
cpf00052  Galactose metabolism
cpf00680  Methane metabolism
cpf01100  Metabolic pathways
cpf01110  Biosynthesis of secondary metabolites
cpf01120  Microbial metabolism in diverse environments
cpf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cpf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPF_1389
   00030 Pentose phosphate pathway
    CPF_1389
   00051 Fructose and mannose metabolism
    CPF_1389
   00052 Galactose metabolism
    CPF_1389
  Energy metabolism
   00680 Methane metabolism
    CPF_1389
Enzymes [BR:cpf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CPF_1389
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     CPF_1389
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: ABG83362
UniProt: A0A0H2YR15
Position
complement(1562304..1563401)
Genome map
AA seq 365 aa AA seqDB search
MQPIKKIAILTGGGDCPGLNAVIRAVTRTAILKYGYEVIGYKFGYRGLYNNDFVKLDLDS
VSGILHRGGTILHSSNKDNLFDYQVEDENGKIVKKDVSDVGVENLKKEEVDALVVIGGDG
TLTSARDFARKGVNVIGVPKTIDNDLLATDVTFGFNTATEIATEALDRLHTTAESHHRIM
LLEVMGRNAGWIALESGIAGSADVILLPEIPYDINKIVEKVKEREEAGKQFTIIVVAEGA
KPKDGEVVVSKIVDDSPDPIRLGGIANKLAIDLEGLIKNHEIRSTVLGHIQRGGNTSTYD
RILSTKYGVKAVELINSNLFGNMVALKGNKVSYESLENVIGHTKNVDPEGELVNTAKSIG
ISFAD
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccaattaagaaaatagctatactaacaggaggaggagattgtcctggattaaat
gcagtaataagagctgtaactagaactgcaatcttaaaatatggatatgaagttataggt
tataaatttggatatagaggtctatataataatgactttgtaaaattggatcttgattct
gtttctggaatacttcatagaggaggaacaatacttcatagttcaaataaggacaaccta
tttgattatcaagttgaagatgagaatggtaaaatagttaaaaaagatgtttctgatgtt
ggtgttgaaaacttaaagaaagaagaggtagatgctctagttgttattggaggagatgga
accttaacctctgcaagagatttcgcaagaaaaggtgttaatgtaataggtgttcctaaa
acaatagataacgatttattagccacagatgtaacctttggatttaatactgccacagaa
atagctacagaagctttagatagacttcatactacagctgagtcacatcatagaataatg
cttttagaagttatgggaagaaacgctggttggattgctttagaatcaggaatagctggt
tctgctgatgtaatattattacctgaaataccttacgatataaacaagatagttgaaaaa
gtaaaagaaagagaagaagccggaaaacagtttacaattattgtagttgcagaaggagca
aaacctaaagatggagaagtagttgtttctaaaatagttgatgatagtccagacccaata
agattagggggaatagctaacaaattagctattgacttagaaggattaataaaaaatcat
gaaataagaagcactgttcttggacatatacaaagagggggaaatacctctacttatgat
agaatactttccactaaatatggagttaaagctgttgaacttataaatagtaatttattt
ggaaacatggttgcattaaaaggaaataaagtatcctatgaaagcttagaaaatgtaatt
ggacatactaaaaatgtagatccagaaggtgaattagtaaacactgctaaaagtatagga
attagtttcgctgattaa

DBGET integrated database retrieval system