KEGG   Clostridium perfringens ATCC 13124: CPF_2078Help
Entry
CPF_2078          CDS       T00378                                 

Gene name
nusB
Definition
(GenBank) N utilization substance protein B
  KO
K03625  transcription antitermination protein NusB
Organism
cpf  Clostridium perfringens ATCC 13124
Brite
KEGG Orthology (KO) [BR:cpf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cpf03021]
    CPF_2078 (nusB)
   03009 Ribosome biogenesis [BR:cpf03009]
    CPF_2078 (nusB)
Transcription machinery [BR:cpf03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     CPF_2078 (nusB)
Ribosome biogenesis [BR:cpf03009]
 Prokaryotic type
  rRNA transcription factors
   CPF_2078 (nusB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NusB
Motif
Other DBs
NCBI-ProteinID: ABG84801
UniProt: Q0TPD3
Position
complement(2317328..2317735)
Genome map
AA seq 135 aa AA seqDB search
MNRVKSREYLLQLAYQMEITSETALETFNSFMENEDISKDDLDLAYIKSGLLGIEENKEK
LDSLIESQLVKWKLNRISKVNLSILRISTYEILFAEDVPGKVSINEAIELCKKYSDNKSV
SFINGVLDKVYKNMQ
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgaatagagtaaaatcaagagaatatttattacaattagcttaccaaatggaaataact
tcagaaactgcattagaaactttcaattcttttatggagaacgaggacatttctaaggat
gatttagatctagcatacataaaatcaggattattaggaatagaagaaaataaggaaaag
ttagattctttaatagaaagtcaacttgtaaaatggaaattaaacagaatttcaaaggtt
aacttatcaattttaagaatttctacatatgaaatattatttgcagaggatgtaccagga
aaggtatcaataaatgaagctattgaattatgtaaaaaatattcagataataaatcagtt
tcatttataaatggagttttagataaagtatataagaatatgcaatag

DBGET integrated database retrieval system