KEGG   Clostridium perfringens ATCC 13124: CPF_2203
Entry
CPF_2203          CDS       T00378                                 

Gene name
ruvB
Definition
(GenBank) Holliday junction DNA helicase RuvB
  KO
K03551  holliday junction DNA helicase RuvB [EC:3.6.4.12]
Organism
cpf  Clostridium perfringens ATCC 13124
Pathway
cpf03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cpf00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    CPF_2203 (ruvB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cpf03400]
    CPF_2203 (ruvB)
Enzymes [BR:cpf01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     CPF_2203 (ruvB)
DNA repair and recombination proteins [BR:cpf03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     CPF_2203 (ruvB)
    RecFOR pathway proteins
     CPF_2203 (ruvB)
SSDB
Motif
Pfam: RuvB_N AAA_lid_4 RuvB_C AAA AAA_5 Mg_chelatase TIP49 AAA_16 RNA_helicase AAA_22 Bac_DnaA AAA_18 NTPase_1 AAA_14 NB-ARC Sigma54_activ_2 DUF815 AAA_3 MCM TsaE ResIII AAA_24 AAA_28 IstB_IS21 ABC_tran AAA_PrkA NACHT AAA_17 T2SSE AAA_25 AAA_33 Parvo_NS1
Other DBs
NCBI-ProteinID: ABG83567
UniProt: Q0TP13
Position
complement(2443566..2444606)
AA seq 346 aa
MSERLVTSNEIGIDSTNEYSLRPEKINEYIGQDKVKERLNIFIKAAQRREEALDHVILYG
PPGLGKTTLANIIANEMGGNLKITSGPAIERAGDLAAILTTLNTNDVLFIDEIHRLNRSV
EEILYPAMEDYVLDIIIGKGAASKSIRLDLPKFTLIGATTRIGMLSSPLRDRFGVLCSME
YYTDEQLKEIIIRSAEILGCHITEEGAFEIAKRSRGTPRIANRLLKRVRDFAEVLYDNEI
TEEAAKKSLEILEVDGEGFDRIDNKILEAIIDNFNGGPVGIETLAYFVGEELDTIEDVYE
PYLLQKGFIVRTPRGRMATDKAYKHLGRVRFNESKIDSKQCTLFEK
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgagtgaaagattagttacctctaatgagattggaatagattcaactaatgaatacagt
ttgagaccagagaaaataaatgaatatataggtcaagataaagttaaagaaagactaaac
atattcataaaagctgctcaaagaagagaggaagccttagatcatgtaattttatatggg
ccaccaggtcttggaaagacaacattagctaatataatagcaaatgaaatgggtggaaat
cttaaaataacatcagggcctgctattgaaagagcaggagatttagcggcaatattaaca
accttaaacactaatgatgttttatttattgatgagatacatagattaaatagaagtgta
gaggaaatactatatcctgccatggaggattatgttttagatataattattggtaaaggg
gctgctagtaaatccataagactcgatttacctaaatttactctaataggtgccacaact
agaattggtatgcttagttcacctttaagagatagatttggggttttatgttctatggaa
tattatactgatgaacaattaaaggaaataataattagaagtgctgaaattttaggatgc
catataactgaagaaggggcctttgaaattgctaaaaggtcaaggggtactcctagaata
gcaaatagacttttaaagagagtaagagattttgcagaagttttatatgataatgaaatt
acagaagaggctgcaaaaaaatccttagagattttagaagttgatggagaaggctttgat
agaattgataataaaattctagaagccataatagataacttcaatggagggccagtaggg
atagaaaccttagcttacttcgttggagaggaattagatactatagaagatgtttatgag
ccatatcttctacaaaaagggtttatagttagaactccaaggggaagaatggcaacagat
aaagcatataaacacttaggaagagttagatttaatgaatctaagatagattctaaacag
tgtacgttatttgaaaaataa

DBGET integrated database retrieval system