KEGG   Clostridium perfringens ATCC 13124: CPF_2382Help
Entry
CPF_2382          CDS       T00378                                 

Gene name
obg
Definition
(GenBank) spo0B-associated GTP-binding protein
  KO
K03979  GTPase [EC:3.6.5.-]
Organism
cpf  Clostridium perfringens ATCC 13124
Brite
KEGG Orthology (KO) [BR:cpf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cpf03009]
    CPF_2382 (obg)
Enzymes [BR:cpf01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.-  
     CPF_2382 (obg)
Ribosome biogenesis [BR:cpf03009]
 Eukaryotic Type
  Other ribosome biogenesis factors
   CPF_2382 (obg)
 Prokaryotic Type
  GTPases
   CPF_2382 (obg)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP1_OBG MMR_HSR1 DUF1967 FeoB_N Ras PduV-EutP RsgA_GTPase Gtr1_RagA
Motif
Other DBs
NCBI-ProteinID: ABG83048
UniProt: Q0TNI5
Position
complement(2652190..2653476)
Genome map
AA seq 428 aa AA seqDB search
MFIDTAKIFVKSGDGGHGSVSFRREKYVPLGGPDGGDGGKGGDVTFVVDPGMTTLLDFKY
KRKFVAGRGQDGQGSKCYGRDGENLTIKVPMGTIIRDVETNKVMADLSHRDDTYTICRGG
KGGKGNCKFCTPTRQAPTFAEPGMPGEERWVALELKLLADVGLLGFPNVGKSTLLSVVTK
AKPKIANYHFTTLKPNLGVVAVPGIEPFVMADVPGIIEGASEGVGLGLDFLRHIERTRLL
IHVVDISGVEGRDAVEDFKRINEELKNYSVKLWDRPQIVVANKCDMLFDEEIFENFKAEV
NKMGFDKVFKMSAATSQGVEEVIKEAARMLKDIPVTDLEIPEDERFIPEDKKFTYTINPI
EEDGLKVYVVEGSFVDRLLLAVNVNDPDSLRYFHKVLNNKGIFHELREMGIEDGDMVRLN
DFEFEYLL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtttatagatacggccaagatatttgtgaaatctggagatggtggtcatggttctgtt
tcttttagaagagaaaaatacgttccacttggtggaccagatggtggagatggtggaaaa
ggtggagatgttacttttgtagtagatccaggaatgacaactcttttagatttcaaatat
aagagaaaattcgtagcaggcagaggacaggacggtcaaggttctaaatgttacggaaga
gatggtgaaaatttaacaataaaggttccaatgggaactataataagagatgttgaaact
aataaggtaatggcagacctttctcatagagatgatacatatacaatctgtagaggtgga
aaaggtggtaagggaaattgtaagttctgtacacctacaagacaggcgccaacttttgct
gagccaggaatgccaggggaagaaagatgggttgctttagaattaaaactattagcagac
gtaggacttttaggattccctaacgttggaaaatcaacattactttcagtggtaactaag
gctaaaccaaagatagctaactatcacttcacaactttaaaacctaatttaggagttgtt
gctgtaccaggaatagagccatttgttatggcagacgtaccaggtattatagaaggagct
tcagagggtgtaggtcttggattagacttcttaagacatatagaaagaacaagactttta
atacacgttgttgatatttcaggagttgaaggaagagacgcagttgaagacttcaagaga
atcaacgaagaattaaagaactacagtgttaaactttgggatagacctcaaatagtagta
gcaaataaatgcgatatgttatttgatgaagaaatttttgaaaacttcaaagctgaagtt
aataaaatgggatttgataaggtatttaaaatgtcagcagctacttcacaaggagtagag
gaagtaataaaagaagcagctagaatgcttaaagatattcctgttactgatttagaaatc
ccagaagatgaaagattcattccagaggataagaagtttacatatactataaatccaata
gaagaagatggattaaaggtttatgtagtagaaggttcatttgtagacagattattatta
gctgttaatgtaaatgatcctgattcattaagatatttccataaggttcttaataataaa
ggaatattccatgagttaagagaaatgggaatagaagatggagatatggtaagattaaac
gactttgagtttgaatacttactataa

DBGET integrated database retrieval system