KEGG   Clostridium perfringens ATCC 13124: CPF_2460Help
Entry
CPF_2460          CDS       T00378                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cpf  Clostridium perfringens ATCC 13124
Pathway
cpf00071  Fatty acid degradation
cpf00280  Valine, leucine and isoleucine degradation
cpf00310  Lysine degradation
cpf00362  Benzoate degradation
cpf00380  Tryptophan metabolism
cpf00620  Pyruvate metabolism
cpf00630  Glyoxylate and dicarboxylate metabolism
cpf00640  Propanoate metabolism
cpf00650  Butanoate metabolism
cpf00900  Terpenoid backbone biosynthesis
cpf01100  Metabolic pathways
cpf01110  Biosynthesis of secondary metabolites
cpf01120  Microbial metabolism in diverse environments
cpf01130  Biosynthesis of antibiotics
cpf01200  Carbon metabolism
cpf01212  Fatty acid metabolism
cpf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cpf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CPF_2460
   00630 Glyoxylate and dicarboxylate metabolism
    CPF_2460
   00640 Propanoate metabolism
    CPF_2460
   00650 Butanoate metabolism
    CPF_2460
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CPF_2460
   00072 Synthesis and degradation of ketone bodies
    CPF_2460
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CPF_2460
   00310 Lysine degradation
    CPF_2460
   00380 Tryptophan metabolism
    CPF_2460
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CPF_2460
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CPF_2460
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CPF_2460
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cpf04147]
    CPF_2460
Enzymes [BR:cpf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CPF_2460
Exosome [BR:cpf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CPF_2460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ABG83108
UniProt: A0A0H2YQ74
Position
complement(2729310..2730488)
Genome map
AA seq 392 aa AA seqDB search
MREVVIASAVRTALGSFGGSLKDVPAVDLGALVIKEALNKAGVKPECVDEVLMGNVIQAG
LGQNPARQAAVKAGLPVEIPSMTINKVCGSGLRCVALAAQMIKAGDADVIVAGGMENMSQ
GPYVLRTARFGQRMGDGKMVDAMVNDALTDAFNGYHMGITAENIAEQWGLTREMQDEFAA
NSQIKAEAAIKAGKFKDEIVPVVIPQRKGDPIVFDTDEFPRFGTTAEKLAKLRPAFKKDG
TVTAGNASGINDGAAALVVMSAEKAKELGVTPICKIVSYGSKGLDPSIMGYGPFYATKKA
LEGTGLTVADLDLIEANEAFAAQSLAVAKDLEFDMSKVNVNGGAIALGHPVGASGARILV
TLLHEMMKRDAKRGLATLCIGGGMGTALIVER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgagagaggtagttattgcaagtgcagtaagaacagcattaggttcatttggtggttca
ttaaaggatgttcctgctgtagatttaggagctttagttattaaagaagctttaaataaa
gctggtgtaaaaccagaatgtgttgatgaagttttaatgggaaatgtaattcaagctgga
ttaggacaaaaccctgcaagacaagcagctgtaaaagctggtttaccagttgaaattcct
tcaatgacaataaataaagtttgtggttcaggtttaagatgtgttgctttagcagctcaa
atgataaaagcaggagatgctgacgtaatagtagctggtggtatggaaaacatgtcacaa
ggaccatatgttttaagaactgcaagatttggtcaaagaatgggcgatggaaaaatggtc
gatgctatggtcaatgatgctttaacagatgcatttaatggataccacatgggtataact
gctgaaaatatagcagaacaatggggattaactagagaaatgcaagatgaatttgctgca
aattctcaaattaaagcagaagcagctataaaagctggaaaattcaaagatgaaatagtt
ccagtagtaattccacaaagaaaaggtgatccaatagtatttgatactgatgaattccct
agatttggaacaactgctgaaaaattagctaagttaagaccagcattcaaaaaagatggt
acagttacagctggtaatgcatcaggtataaatgatggtgctgctgcattagttgttatg
agtgctgaaaaagcaaaagaattaggagtaactccaatttgtaaaatagtttcttatggt
tcaaaaggattagatccttcaattatgggttatggaccattctatgctactaaaaaagct
ttagaaggaactggattaacagttgcagatcttgatttaatagaagcaaatgaagctttt
gcagctcaaagtttagcagttgctaaagatttagaatttgatatgagtaaagttaacgta
aatggtggagctatagctttaggacatccagtaggagcttcaggggctagaatattagtt
acattacttcacgaaatgatgaaaagagatgctaagagaggtttagcaacactttgtata
ggtggaggaatgggaactgctttaatagtagaaagataa

DBGET integrated database retrieval system