KEGG   Clostridium perfringens ATCC 13124: CPF_2683
Entry
CPF_2683          CDS       T00378                                 

Definition
(GenBank) cobalt ABC transporter, ATP-binding protein
  KO
K16786  energy-coupling factor transport system ATP-binding protein [EC:3.6.3.-]
Organism
cpf  Clostridium perfringens ATCC 13124
Pathway
cpf02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:cpf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CPF_2683
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cpf02000]
    CPF_2683
Enzymes [BR:cpf01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Catalysing transmembrane movement of substances
    3.6.3.-  
     CPF_2683
Transporters [BR:cpf02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Energy-coupling factor transporter
    Shared module
     CPF_2683
SSDB
Motif
Pfam: ABC_tran SMC_N AAA_21 AAA_22 AAA_29 AAA_15 TniB ATPase_2 AAA_18 SRP54 AAA_25 DUF2096 AAA_24 RsgA_GTPase Mg_chelatase DSBA AAA_23 AAA_5 AAA_16 G-alpha AAA_27 RNA_helicase AAA_33 AAA_30 ATP_bind_1 APS_kinase
Other DBs
NCBI-ProteinID: ABG84809
UniProt: Q0TMS7
Position
complement(2958196..2959041)
AA seq 281 aa
MGENMIKSEDLVFKYVNAEEQTEKVAINHVSMEVKKGEFLVILGHNGSGKSTMAKHMNAL
LLPSGGKMYVDGLDTSDIENLWEVRRRAGMVFQNPDNQLVATIVEEDVAFGPENLGVDPK
EIRERVDDSLKAVGMYEYRKHAPHLLSGGQKQRIAIAGILAMRPKCIVLDEPTAMLDPSG
RNEVMKTIKEVNKKFGITIILITHYMDEAAQADRIIVMDKGEKVMEGVPREIFSQVEKIK
SIGLDVPQVTELAYELQKEGVDISTEILNIDEMVNALCQLK
NT seq 846 nt   +upstreamnt  +downstreamnt
atgggagaaaatatgattaaaagtgaagacttagtttttaaatatgtcaatgctgaagaa
caaactgaaaaggttgcaataaatcacgtttctatggaagttaaaaagggagaattttta
gttatattaggtcataacggttcaggaaaatcaactatggcaaagcatatgaatgcttta
ttacttcctagtggtggaaagatgtatgtagatggattagatacttctgatatagaaaat
ctttgggaagttagaagaagagctggaatggtttttcaaaatccagataatcaattagta
gcaacaatagttgaagaagatgtggcttttggaccagagaatttaggtgttgatccgaag
gagataagagaaagagtagatgattcattaaaagcagtaggtatgtatgagtatagaaaa
catgcaccacatttattatcaggagggcaaaagcagagaattgctattgcgggtatatta
gcaatgagacctaaatgcatagtattagatgaacctacagcaatgctagatccttcaggt
agaaatgaagtaatgaaaactataaaggaagtaaataaaaagtttggaattactataata
cttataactcactatatggatgaagctgcacaagctgatagaataatagttatggataaa
ggtgaaaaggtaatggaaggggttcctagggaaattttttctcaagtagaaaaaataaag
tcaattgggttagatgttcctcaagttactgaattagcttatgagcttcaaaaagaggga
gtagatatatcaacagaaatattaaatatagatgagatggtgaatgctttatgtcaatta
aaatag

DBGET integrated database retrieval system